Detailed information
Bioinformatically predicted
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | DOU31_RS05315 | Genome accession | NZ_CP030042 |
| Coordinates | 1067686..1067961 (+) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain C25 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1067985..1113592 | 1067686..1067961 | flank | 24 |
Gene organization within MGE regions
Location: 1067686..1113592
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DOU31_RS05315 (DOU31_05310) | comGC/cglC | 1067686..1067961 (+) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| DOU31_RS05320 (DOU31_05315) | comGD | 1067958..1068395 (+) | 438 | WP_138807094.1 | competence type IV pilus minor pilin ComGD | - |
| DOU31_RS05325 (DOU31_05320) | - | 1068429..1069577 (-) | 1149 | WP_138807096.1 | tyrosine-type recombinase/integrase | - |
| DOU31_RS05330 (DOU31_05325) | - | 1069674..1070402 (-) | 729 | WP_138807098.1 | ion transporter | - |
| DOU31_RS05335 (DOU31_05330) | - | 1070436..1070780 (-) | 345 | WP_002395798.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DOU31_RS05340 (DOU31_05335) | - | 1070798..1071121 (-) | 324 | WP_010826721.1 | helix-turn-helix domain-containing protein | - |
| DOU31_RS05345 (DOU31_05340) | - | 1071432..1071608 (+) | 177 | WP_002364354.1 | helix-turn-helix domain-containing protein | - |
| DOU31_RS05350 (DOU31_05345) | - | 1071619..1071930 (+) | 312 | WP_002381719.1 | hypothetical protein | - |
| DOU31_RS05355 (DOU31_05350) | - | 1071937..1072116 (+) | 180 | WP_002395800.1 | hypothetical protein | - |
| DOU31_RS15285 (DOU31_05355) | - | 1072117..1072533 (+) | 417 | WP_236922055.1 | hypothetical protein | - |
| DOU31_RS05365 (DOU31_05360) | - | 1072748..1072948 (+) | 201 | WP_105194762.1 | hypothetical protein | - |
| DOU31_RS05370 (DOU31_05365) | - | 1072945..1073238 (+) | 294 | WP_010826715.1 | VRR-NUC domain-containing protein | - |
| DOU31_RS05375 (DOU31_05370) | - | 1073228..1074424 (+) | 1197 | WP_016626781.1 | DEAD/DEAH box helicase | - |
| DOU31_RS05380 (DOU31_05375) | - | 1074426..1074668 (+) | 243 | WP_010826713.1 | hypothetical protein | - |
| DOU31_RS05385 (DOU31_05380) | - | 1074681..1075592 (+) | 912 | WP_138807100.1 | YqaJ viral recombinase family protein | - |
| DOU31_RS05390 (DOU31_05385) | - | 1075594..1075812 (+) | 219 | WP_002407623.1 | hypothetical protein | - |
| DOU31_RS05395 (DOU31_05390) | - | 1075829..1076353 (+) | 525 | WP_104858190.1 | NUMOD4 domain-containing protein | - |
| DOU31_RS05400 (DOU31_05395) | - | 1076331..1077251 (+) | 921 | WP_128722480.1 | AAA family ATPase | - |
| DOU31_RS05405 (DOU31_05400) | - | 1077302..1077814 (+) | 513 | WP_138807102.1 | hypothetical protein | - |
| DOU31_RS05410 (DOU31_05405) | - | 1077837..1079399 (+) | 1563 | WP_105194765.1 | hypothetical protein | - |
| DOU31_RS05415 (DOU31_05410) | - | 1079396..1080148 (-) | 753 | WP_162301521.1 | DUF4145 domain-containing protein | - |
| DOU31_RS05420 (DOU31_05415) | - | 1080224..1082077 (+) | 1854 | WP_105194767.1 | DNA primase family protein | - |
| DOU31_RS05425 (DOU31_05420) | - | 1082385..1082801 (+) | 417 | WP_010826705.1 | sigma-70 family RNA polymerase sigma factor | - |
| DOU31_RS05430 (DOU31_05425) | - | 1082933..1083334 (+) | 402 | WP_138807104.1 | hypothetical protein | - |
| DOU31_RS05435 (DOU31_05430) | - | 1083334..1083702 (+) | 369 | WP_002393035.1 | HNH endonuclease | - |
| DOU31_RS05440 (DOU31_05435) | - | 1083815..1084267 (+) | 453 | WP_105194768.1 | P27 family phage terminase small subunit | - |
| DOU31_RS05445 (DOU31_05440) | - | 1084264..1085991 (+) | 1728 | WP_105194769.1 | terminase large subunit | - |
| DOU31_RS05450 (DOU31_05445) | - | 1086010..1087221 (+) | 1212 | WP_138807106.1 | phage portal protein | - |
| DOU31_RS05455 (DOU31_05450) | - | 1087208..1087780 (+) | 573 | WP_002393031.1 | HK97 family phage prohead protease | - |
| DOU31_RS05460 (DOU31_05455) | - | 1087792..1089153 (+) | 1362 | WP_105194770.1 | phage major capsid protein | - |
| DOU31_RS05465 (DOU31_05460) | - | 1089156..1089437 (+) | 282 | WP_002395304.1 | phage gp6-like head-tail connector protein | - |
| DOU31_RS05470 (DOU31_05465) | - | 1089415..1089741 (+) | 327 | WP_002373974.1 | phage head closure protein | - |
| DOU31_RS05475 (DOU31_05470) | - | 1089731..1090069 (+) | 339 | WP_002398474.1 | hypothetical protein | - |
| DOU31_RS05480 (DOU31_05475) | - | 1090059..1090421 (+) | 363 | WP_105194771.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| DOU31_RS05485 (DOU31_05480) | - | 1090418..1091065 (+) | 648 | WP_105194772.1 | phage tail protein | - |
| DOU31_RS05490 (DOU31_05485) | - | 1091065..1091520 (+) | 456 | WP_002395308.1 | hypothetical protein | - |
| DOU31_RS05495 (DOU31_05490) | - | 1091712..1094015 (+) | 2304 | WP_138807108.1 | phage tail tape measure protein | - |
| DOU31_RS05500 (DOU31_05495) | - | 1094012..1094725 (+) | 714 | WP_162301522.1 | phage tail protein | - |
| DOU31_RS05505 (DOU31_05500) | - | 1094722..1097517 (+) | 2796 | WP_138807110.1 | phage tail tip lysozyme | - |
| DOU31_RS05510 (DOU31_05505) | - | 1097536..1098417 (+) | 882 | WP_138807112.1 | phage baseplate upper protein | - |
| DOU31_RS05515 (DOU31_05510) | - | 1098410..1099006 (+) | 597 | WP_138807114.1 | hypothetical protein | - |
| DOU31_RS05520 (DOU31_05515) | - | 1099003..1099290 (+) | 288 | WP_002365086.1 | collagen-like protein | - |
| DOU31_RS05525 (DOU31_05520) | - | 1099290..1099799 (+) | 510 | WP_138807116.1 | hypothetical protein | - |
| DOU31_RS05530 (DOU31_05525) | - | 1099816..1100190 (+) | 375 | WP_002402192.1 | hypothetical protein | - |
| DOU31_RS05535 (DOU31_05530) | - | 1100190..1100327 (+) | 138 | WP_002399193.1 | XkdX family protein | - |
| DOU31_RS05540 (DOU31_05535) | - | 1100361..1100594 (+) | 234 | WP_002383824.1 | hemolysin XhlA family protein | - |
| DOU31_RS05545 (DOU31_05540) | - | 1100597..1100803 (+) | 207 | WP_010784051.1 | phage holin | - |
| DOU31_RS05550 (DOU31_05545) | - | 1100806..1101906 (+) | 1101 | WP_138807118.1 | SH3 domain-containing protein | - |
| DOU31_RS05555 (DOU31_05550) | - | 1102057..1102428 (+) | 372 | WP_181444836.1 | type II secretion system protein | - |
| DOU31_RS05560 (DOU31_05555) | comGF | 1102418..1102852 (+) | 435 | WP_002398461.1 | competence type IV pilus minor pilin ComGF | - |
| DOU31_RS05565 (DOU31_05560) | comGG | 1102852..1103205 (+) | 354 | WP_002360027.1 | competence type IV pilus minor pilin ComGG | - |
| DOU31_RS05570 (DOU31_05565) | - | 1103334..1104341 (+) | 1008 | WP_138807122.1 | class I SAM-dependent methyltransferase | - |
| DOU31_RS05575 (DOU31_05570) | - | 1104366..1105553 (+) | 1188 | WP_002398460.1 | acetate/propionate family kinase | - |
| DOU31_RS05580 (DOU31_05575) | - | 1105665..1106138 (-) | 474 | WP_002357065.1 | universal stress protein | - |
| DOU31_RS05590 (DOU31_05585) | - | 1106316..1106648 (-) | 333 | WP_002357068.1 | hypothetical protein | - |
| DOU31_RS05600 (DOU31_05595) | - | 1106922..1108199 (-) | 1278 | WP_002360030.1 | replication-associated recombination protein A | - |
| DOU31_RS05605 (DOU31_05600) | - | 1108328..1109005 (+) | 678 | WP_010717036.1 | DNA-3-methyladenine glycosylase | - |
| DOU31_RS05610 (DOU31_05605) | - | 1108962..1109447 (+) | 486 | WP_010717035.1 | DUF3013 family protein | - |
| DOU31_RS05615 (DOU31_05610) | prmA | 1109463..1110410 (+) | 948 | WP_002357075.1 | 50S ribosomal protein L11 methyltransferase | - |
| DOU31_RS05620 (DOU31_05615) | - | 1110412..1111164 (+) | 753 | WP_002357078.1 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
| DOU31_RS05625 (DOU31_05620) | - | 1111379..1113592 (+) | 2214 | WP_002357079.1 | RelA/SpoT family protein | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=298681 DOU31_RS05315 WP_002356991.1 1067686..1067961(+) (comGC/cglC) [Enterococcus faecalis strain C25]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=298681 DOU31_RS05315 WP_002356991.1 1067686..1067961(+) (comGC/cglC) [Enterococcus faecalis strain C25]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |