Detailed information
Bioinformatically predicted
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | C7I32_RS10910 | Genome accession | NZ_CP028720 |
| Coordinates | 2155581..2155856 (+) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain CVM N48037F | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2155880..2198189 | 2155581..2155856 | flank | 24 |
Gene organization within MGE regions
Location: 2155581..2198189
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| C7I32_RS10910 | comGC/cglC | 2155581..2155856 (+) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| C7I32_RS10915 | comGD | 2155853..2156287 (+) | 435 | Protein_1995 | competence type IV pilus minor pilin ComGD | - |
| C7I32_RS10920 | - | 2156324..2157472 (-) | 1149 | WP_002387264.1 | site-specific integrase | - |
| C7I32_RS10925 | - | 2157578..2158207 (-) | 630 | WP_002410530.1 | SHOCT domain-containing protein | - |
| C7I32_RS10930 | - | 2158303..2158953 (-) | 651 | WP_002387266.1 | ImmA/IrrE family metallo-endopeptidase | - |
| C7I32_RS10935 | - | 2158958..2159299 (-) | 342 | WP_002387267.1 | helix-turn-helix transcriptional regulator | - |
| C7I32_RS10940 | - | 2159595..2159786 (+) | 192 | WP_002383936.1 | hypothetical protein | - |
| C7I32_RS10945 | - | 2159798..2160109 (+) | 312 | WP_002403885.1 | hypothetical protein | - |
| C7I32_RS10950 | - | 2160132..2160854 (+) | 723 | WP_002410531.1 | Rha family transcriptional regulator | - |
| C7I32_RS10955 | - | 2160880..2161068 (-) | 189 | WP_002357001.1 | YegP family protein | - |
| C7I32_RS10960 | - | 2161123..2161332 (+) | 210 | WP_002378465.1 | hypothetical protein | - |
| C7I32_RS10965 | - | 2161369..2161707 (+) | 339 | WP_002402484.1 | hypothetical protein | - |
| C7I32_RS10975 | - | 2161903..2162220 (+) | 318 | WP_002402485.1 | hypothetical protein | - |
| C7I32_RS10980 | - | 2162213..2162947 (+) | 735 | WP_002402486.1 | ERF family protein | - |
| C7I32_RS10985 | - | 2162952..2163593 (+) | 642 | WP_002402487.1 | putative HNHc nuclease | - |
| C7I32_RS10990 | - | 2163598..2163798 (+) | 201 | WP_010715320.1 | hypothetical protein | - |
| C7I32_RS10995 | - | 2163798..2164682 (+) | 885 | WP_131501893.1 | helix-turn-helix domain-containing protein | - |
| C7I32_RS11000 | - | 2164679..2164981 (+) | 303 | WP_002368214.1 | hypothetical protein | - |
| C7I32_RS11005 | - | 2164982..2165281 (+) | 300 | WP_002372047.1 | MazG-like family protein | - |
| C7I32_RS11010 | - | 2165290..2165724 (+) | 435 | WP_002402491.1 | RusA family crossover junction endodeoxyribonuclease | - |
| C7I32_RS11020 | - | 2166631..2167047 (+) | 417 | WP_002372045.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| C7I32_RS11035 | - | 2168042..2168275 (+) | 234 | WP_002410538.1 | hypothetical protein | - |
| C7I32_RS11040 | - | 2168419..2168997 (+) | 579 | WP_002370953.1 | sce7726 family protein | - |
| C7I32_RS11045 | - | 2169035..2169952 (-) | 918 | WP_002370955.1 | beta family protein | - |
| C7I32_RS11050 | terS | 2170221..2171024 (+) | 804 | WP_002389117.1 | phage terminase small subunit | - |
| C7I32_RS11055 | - | 2170996..2172285 (+) | 1290 | WP_002393615.1 | PBSX family phage terminase large subunit | - |
| C7I32_RS11060 | - | 2172297..2173784 (+) | 1488 | WP_002393614.1 | phage portal protein | - |
| C7I32_RS11065 | - | 2173759..2175663 (+) | 1905 | WP_002393613.1 | hypothetical protein | - |
| C7I32_RS11070 | - | 2175664..2175894 (+) | 231 | WP_002380437.1 | hypothetical protein | - |
| C7I32_RS11075 | - | 2175951..2176271 (+) | 321 | WP_002380436.1 | hypothetical protein | - |
| C7I32_RS11080 | - | 2176490..2177113 (+) | 624 | WP_002393977.1 | DUF4355 domain-containing protein | - |
| C7I32_RS11085 | - | 2177127..2178014 (+) | 888 | WP_002357030.1 | DUF5309 domain-containing protein | - |
| C7I32_RS11090 | - | 2178043..2178225 (+) | 183 | WP_002357032.1 | hypothetical protein | - |
| C7I32_RS11095 | - | 2178239..2178583 (+) | 345 | WP_002357033.1 | hypothetical protein | - |
| C7I32_RS11100 | - | 2178580..2178948 (+) | 369 | WP_002357034.1 | hypothetical protein | - |
| C7I32_RS11105 | - | 2178941..2179339 (+) | 399 | WP_002357036.1 | HK97 gp10 family phage protein | - |
| C7I32_RS11110 | - | 2179342..2179737 (+) | 396 | WP_033626581.1 | DUF6838 family protein | - |
| C7I32_RS11115 | - | 2179716..2180564 (+) | 849 | WP_002387287.1 | major tail protein | - |
| C7I32_RS11120 | gpG | 2180617..2180967 (+) | 351 | WP_002357039.1 | phage tail assembly chaperone G | - |
| C7I32_RS11125 | - | 2181215..2184112 (+) | 2898 | WP_002410539.1 | tape measure protein | - |
| C7I32_RS11130 | - | 2184102..2184836 (+) | 735 | WP_002403868.1 | tail protein | - |
| C7I32_RS11135 | - | 2184818..2187625 (+) | 2808 | WP_033626582.1 | phage tail spike protein | - |
| C7I32_RS11140 | - | 2187644..2188525 (+) | 882 | WP_002387290.1 | phage baseplate upper protein | - |
| C7I32_RS11145 | - | 2188518..2189114 (+) | 597 | WP_002357045.1 | hypothetical protein | - |
| C7I32_RS11150 | - | 2189111..2189398 (+) | 288 | WP_002357046.1 | collagen-like protein | - |
| C7I32_RS11155 | - | 2189398..2189889 (+) | 492 | WP_002364194.1 | hypothetical protein | - |
| C7I32_RS11160 | - | 2189903..2190223 (+) | 321 | WP_002389262.1 | hypothetical protein | - |
| C7I32_RS11165 | - | 2190225..2190380 (+) | 156 | WP_002364192.1 | XkdX family protein | - |
| C7I32_RS11170 | - | 2190415..2190636 (+) | 222 | WP_002364191.1 | hypothetical protein | - |
| C7I32_RS11175 | - | 2190629..2190862 (+) | 234 | WP_033626583.1 | phage holin | - |
| C7I32_RS11180 | - | 2190863..2192104 (+) | 1242 | WP_002394567.1 | LysM peptidoglycan-binding domain-containing protein | - |
| C7I32_RS11185 | - | 2192941..2193141 (+) | 201 | WP_002357053.1 | cold-shock protein | - |
| C7I32_RS11190 | - | 2193213..2193464 (+) | 252 | WP_002364188.1 | hypothetical protein | - |
| C7I32_RS11200 | hemH | 2194208..2195149 (+) | 942 | WP_033595884.1 | ferrochelatase | - |
| C7I32_RS16430 | - | 2195446..2195571 (-) | 126 | WP_002364184.1 | hypothetical protein | - |
| C7I32_RS11210 | - | 2195875..2196276 (+) | 402 | WP_002410542.1 | type II secretion system protein | - |
| C7I32_RS11215 | comGF | 2196266..2196700 (+) | 435 | WP_002362055.1 | competence type IV pilus minor pilin ComGF | - |
| C7I32_RS11220 | comGG | 2196700..2197053 (+) | 354 | WP_033626584.1 | competence type IV pilus minor pilin ComGG | - |
| C7I32_RS11225 | - | 2197182..2198189 (+) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=286708 C7I32_RS10910 WP_002356991.1 2155581..2155856(+) (comGC/cglC) [Enterococcus faecalis strain CVM N48037F]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=286708 C7I32_RS10910 WP_002356991.1 2155581..2155856(+) (comGC/cglC) [Enterococcus faecalis strain CVM N48037F]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |