Detailed information NTG0026582

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: LACR_RS11725
• Genome accession: NC_008527
• Coordinates: 2249268..2249618 (-)
• Length: 116 a.a.
• NCBI ID: WP_050574401.1
• Uniprot ID: -
• Organism: Lactococcus cremoris subsp. cremoris SK11
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
ICE	2243338..2251446	2249268..2249618	within	0

Gene organization within MGE regions

Location: 2243338..2251446

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LACR_RS11685 (LACR_2417)	-	2244804..2245613 (-)	810	WP_011677177.1	metal ABC transporter permease	-
LACR_RS11690 (LACR_2418)	-	2245606..2246343 (-)	738	WP_011677178.1	metal ABC transporter ATP-binding protein	-
LACR_RS11695 (LACR_2419)	-	2246522..2247364 (-)	843	WP_011677179.1	metal ABC transporter solute-binding protein, Zn/Mn family	-
LACR_RS11700 (LACR_2420)	-	2247361..2247798 (-)	438	WP_011677180.1	zinc-dependent MarR family transcriptional regulator	-
LACR_RS11705 (LACR_2421)	comGG	2247878..2248177 (-)	300	WP_011677181.1	competence type IV pilus minor pilin ComGG	Machinery gene
LACR_RS11710 (LACR_2422)	comGF	2248201..2248647 (-)	447	WP_041167483.1	competence type IV pilus minor pilin ComGF	Machinery gene
LACR_RS11715 (LACR_2423)	comGE	2248610..2248906 (-)	297	WP_011677183.1	competence type IV pilus minor pilin ComGE	Machinery gene
LACR_RS14670 (LACR_2424)	comGD	2248878..2249066 (-)	189	WP_014573336.1	hypothetical protein	Machinery gene
LACR_RS11725 (LACR_2425)	comGC	2249268..2249618 (-)	351	WP_050574401.1	competence type IV pilus major pilin ComGC	Machinery gene
LACR_RS11730 (LACR_2426)	comGB	2249663..2250689 (-)	1027	Protein_2284	competence type IV pilus assembly protein ComGB	-
LACR_RS11735	-	2250589..2251410 (-)	822	Protein_2285	ATPase, T2SS/T4P/T4SS family	-

Sequence

Protein

• Length: 116 a.a.
• Molecular weight: 13289.44 Da
• Isoelectric Point: 7.2003

>NTDB_id=26582 LACR_RS11725 WP_050574401.1 2249268..2249618(-) (comGC) [Lactococcus cremoris subsp. cremoris SK11]
MSKALSLIKIHGRKLWQKKQKAFTLIEMLIVLAIISILILLFVPNLIKEKAQVQKTGEAAVVKVVESQAQLYELDHDNDK
PNLSELLSAGMITQKQVTAYDDYYDQNKNEQRNFDD

Nucleotide

• Length: 351 bp

>NTDB_id=26582 LACR_RS11725 WP_050574401.1 2249268..2249618(-) (comGC) [Lactococcus cremoris subsp. cremoris SK11]
ATGAGCAAAGCTTTGTCATTAATTAAAATTCACGGAAGAAAGCTTTGGCAAAAAAAGCAAAAAGCATTTACCTTGATTGA
GATGTTAATTGTGTTGGCAATTATCAGTATTTTAATTTTGCTTTTTGTGCCAAATTTGATAAAAGAAAAAGCACAAGTTC
AAAAAACTGGTGAAGCAGCAGTAGTTAAAGTAGTTGAAAGTCAGGCACAACTTTATGAGTTGGATCATGATAATGATAAG
CCAAACCTATCAGAACTTTTAAGTGCGGGGATGATTACGCAAAAGCAAGTCACGGCCTATGATGATTACTATGACCAGAA
TAAAAATGAACAGCGCAATTTCGATGATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (18-41)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Lactococcus lactis subsp. cremoris KW2	98.276	100	0.983
comYC	Streptococcus gordonii str. Challis substr. CH1	58.586	85.345	0.5
comGC/cglC	Streptococcus mitis SK321	55.882	87.931	0.491
comGC/cglC	Streptococcus pneumoniae R6	53.922	87.931	0.474
comGC/cglC	Streptococcus pneumoniae TIGR4	53.922	87.931	0.474
comGC/cglC	Streptococcus pneumoniae Rx1	53.922	87.931	0.474
comGC/cglC	Streptococcus pneumoniae D39	53.922	87.931	0.474
comYC	Streptococcus mutans UA140	59.14	80.172	0.474
comYC	Streptococcus mutans UA159	59.14	80.172	0.474
comGC/cglC	Streptococcus mitis NCTC 12261	55.67	83.621	0.466
comYC	Streptococcus suis isolate S10	56.818	75.862	0.431