Detailed information
Bioinformatically predicted
Overview
| Name | comGD | Type | Machinery gene |
| Locus tag | LACR_RS14670 | Genome accession | NC_008527 |
| Coordinates | 2248878..2249066 (-) | Length | 62 a.a. |
| NCBI ID | WP_014573336.1 | Uniprot ID | - |
| Organism | Lactococcus cremoris subsp. cremoris SK11 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 2243338..2251446 | 2248878..2249066 | within | 0 |
Gene organization within MGE regions
Location: 2243338..2251446
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LACR_RS11685 (LACR_2417) | - | 2244804..2245613 (-) | 810 | WP_011677177.1 | metal ABC transporter permease | - |
| LACR_RS11690 (LACR_2418) | - | 2245606..2246343 (-) | 738 | WP_011677178.1 | metal ABC transporter ATP-binding protein | - |
| LACR_RS11695 (LACR_2419) | - | 2246522..2247364 (-) | 843 | WP_011677179.1 | metal ABC transporter solute-binding protein, Zn/Mn family | - |
| LACR_RS11700 (LACR_2420) | - | 2247361..2247798 (-) | 438 | WP_011677180.1 | zinc-dependent MarR family transcriptional regulator | - |
| LACR_RS11705 (LACR_2421) | comGG | 2247878..2248177 (-) | 300 | WP_011677181.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| LACR_RS11710 (LACR_2422) | comGF | 2248201..2248647 (-) | 447 | WP_041167483.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| LACR_RS11715 (LACR_2423) | comGE | 2248610..2248906 (-) | 297 | WP_011677183.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| LACR_RS14670 (LACR_2424) | comGD | 2248878..2249066 (-) | 189 | WP_014573336.1 | hypothetical protein | Machinery gene |
| LACR_RS11725 (LACR_2425) | comGC | 2249268..2249618 (-) | 351 | WP_050574401.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| LACR_RS11730 (LACR_2426) | comGB | 2249663..2250689 (-) | 1027 | Protein_2284 | competence type IV pilus assembly protein ComGB | - |
| LACR_RS11735 | - | 2250589..2251410 (-) | 822 | Protein_2285 | ATPase, T2SS/T4P/T4SS family | - |
Sequence
Protein
Download Length: 62 a.a. Molecular weight: 7336.65 Da Isoelectric Point: 8.3463
>NTDB_id=26591 LACR_RS14670 WP_014573336.1 2248878..2249066(-) (comGD) [Lactococcus cremoris subsp. cremoris SK11]
MIYENKEIDIPKEVEMAEFLIIFDEKGGNSSLQKIKVYLPYEKKTILYQMEMGSGKYKKKIN
MIYENKEIDIPKEVEMAEFLIIFDEKGGNSSLQKIKVYLPYEKKTILYQMEMGSGKYKKKIN
Nucleotide
Download Length: 189 bp
>NTDB_id=26591 LACR_RS14670 WP_014573336.1 2248878..2249066(-) (comGD) [Lactococcus cremoris subsp. cremoris SK11]
TTGATTTATGAAAACAAAGAGATAGATATTCCCAAAGAGGTTGAAATGGCAGAATTTTTGATTATATTTGATGAGAAAGG
GGGGAACTCAAGTTTACAGAAAATCAAAGTTTATTTACCTTATGAGAAGAAAACAATTTTATATCAAATGGAGATGGGGA
GTGGAAAATATAAAAAGAAAATCAATTAA
TTGATTTATGAAAACAAAGAGATAGATATTCCCAAAGAGGTTGAAATGGCAGAATTTTTGATTATATTTGATGAGAAAGG
GGGGAACTCAAGTTTACAGAAAATCAAAGTTTATTTACCTTATGAGAAGAAAACAATTTTATATCAAATGGAGATGGGGA
GTGGAAAATATAAAAAGAAAATCAATTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGD | Lactococcus lactis subsp. cremoris KW2 |
93.548 |
100 |
0.935 |
| comYD | Streptococcus mutans UA140 |
43.396 |
85.484 |
0.371 |
| comYD | Streptococcus mutans UA159 |
43.396 |
85.484 |
0.371 |