Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | LACR_RS10290 | Genome accession | NC_008527 |
| Coordinates | 2007398..2007823 (-) | Length | 141 a.a. |
| NCBI ID | WP_011676939.1 | Uniprot ID | A0AA34TL31 |
| Organism | Lactococcus cremoris subsp. cremoris SK11 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1972139..2015853 | 2007398..2007823 | within | 0 |
Gene organization within MGE regions
Location: 1972139..2015853
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LACR_RS10070 (LACR_2082) | pknB | 1972139..1974016 (-) | 1878 | WP_011676897.1 | Stk1 family PASTA domain-containing Ser/Thr kinase | - |
| LACR_RS10075 (LACR_2083) | - | 1974016..1974792 (-) | 777 | WP_011676898.1 | Stp1/IreP family PP2C-type Ser/Thr phosphatase | - |
| LACR_RS10080 (LACR_2084) | rsmB | 1974915..1976189 (-) | 1275 | WP_011676899.1 | 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB | - |
| LACR_RS10085 (LACR_2085) | - | 1976477..1977103 (-) | 627 | WP_011676900.1 | hypothetical protein | - |
| LACR_RS10090 (LACR_2086) | - | 1977214..1978152 (-) | 939 | WP_041167469.1 | glycosyltransferase family 2 protein | - |
| LACR_RS10095 (LACR_2087) | - | 1978070..1979671 (-) | 1602 | WP_011676902.1 | glycosyltransferase family 39 protein | - |
| LACR_RS10100 (LACR_2088) | - | 1979811..1980590 (-) | 780 | WP_063284079.1 | peptidoglycan amidohydrolase family protein | - |
| LACR_RS14765 | - | 1980678..1980878 (-) | 201 | Protein_1971 | phage holin | - |
| LACR_RS10105 (LACR_2089) | - | 1980891..1981262 (-) | 372 | WP_011676904.1 | hypothetical protein | - |
| LACR_RS13955 (LACR_2090) | - | 1981280..1982737 (-) | 1458 | WP_050748314.1 | hypothetical protein | - |
| LACR_RS14120 (LACR_2091) | - | 1982737..1982874 (-) | 138 | WP_011676905.1 | hypothetical protein | - |
| LACR_RS10120 (LACR_2092) | - | 1982871..1985372 (-) | 2502 | WP_041167470.1 | gp58-like family protein | - |
| LACR_RS10125 (LACR_2093) | - | 1985384..1985749 (-) | 366 | WP_011676906.1 | DUF6711 family protein | - |
| LACR_RS10130 (LACR_2094) | - | 1985761..1990461 (-) | 4701 | WP_011676907.1 | tail protein | - |
| LACR_RS10135 (LACR_2095) | - | 1990493..1990864 (-) | 372 | WP_011676908.1 | hypothetical protein | - |
| LACR_RS10140 (LACR_2096) | - | 1990888..1991298 (-) | 411 | WP_011676909.1 | DUF6096 family protein | - |
| LACR_RS10145 (LACR_2097) | - | 1991372..1991785 (-) | 414 | WP_011676910.1 | phage tail tube protein | - |
| LACR_RS10150 (LACR_2098) | - | 1991798..1992160 (-) | 363 | WP_011676911.1 | hypothetical protein | - |
| LACR_RS10155 (LACR_2099) | - | 1992160..1992708 (-) | 549 | WP_011676912.1 | hypothetical protein | - |
| LACR_RS10160 (LACR_2100) | - | 1992692..1993045 (-) | 354 | WP_041167471.1 | hypothetical protein | - |
| LACR_RS10165 (LACR_2101) | - | 1993026..1993352 (-) | 327 | WP_011676914.1 | phage head-tail connector protein | - |
| LACR_RS10170 (LACR_2102) | - | 1993373..1994491 (-) | 1119 | WP_011676915.1 | Ig-like domain-containing protein | - |
| LACR_RS10175 (LACR_2103) | - | 1994503..1995159 (-) | 657 | WP_041167616.1 | DUF4355 domain-containing protein | - |
| LACR_RS10180 (LACR_2104) | - | 1995324..1996430 (-) | 1107 | WP_011676917.1 | minor capsid protein | - |
| LACR_RS10185 (LACR_2105) | - | 1996436..1996723 (-) | 288 | WP_011676918.1 | ribosomal-processing cysteine protease Prp | - |
| LACR_RS10190 (LACR_2106) | - | 1996720..1996950 (-) | 231 | WP_041167618.1 | hypothetical protein | - |
| LACR_RS14125 (LACR_2107) | - | 1996992..1997156 (-) | 165 | WP_011676920.1 | hypothetical protein | - |
| LACR_RS10195 (LACR_2108) | - | 1997113..1998621 (-) | 1509 | WP_011676921.1 | phage portal protein | - |
| LACR_RS10200 (LACR_2109) | - | 1998630..1999865 (-) | 1236 | WP_011676922.1 | PBSX family phage terminase large subunit | - |
| LACR_RS10205 (LACR_2110) | - | 1999855..2000367 (-) | 513 | WP_011676923.1 | terminase small subunit | - |
| LACR_RS10210 (LACR_2111) | - | 2000663..2001088 (-) | 426 | WP_003131928.1 | RinA family protein | - |
| LACR_RS10215 (LACR_2112) | - | 2001165..2001473 (-) | 309 | WP_011676924.1 | hypothetical protein | - |
| LACR_RS10220 (LACR_2113) | - | 2001806..2002018 (-) | 213 | WP_237024555.1 | hypothetical protein | - |
| LACR_RS10225 (LACR_2114) | - | 2001999..2002193 (-) | 195 | WP_011676926.1 | DUF1660 domain-containing protein | - |
| LACR_RS10230 (LACR_2115) | - | 2002190..2002432 (-) | 243 | WP_011676927.1 | hypothetical protein | - |
| LACR_RS10235 (LACR_2116) | - | 2002483..2003169 (-) | 687 | WP_011676928.1 | hypothetical protein | - |
| LACR_RS10240 (LACR_2117) | - | 2003156..2003467 (-) | 312 | WP_011676929.1 | hypothetical protein | - |
| LACR_RS10245 (LACR_2118) | dut | 2003467..2003886 (-) | 420 | WP_011676930.1 | dUTP diphosphatase | - |
| LACR_RS13470 (LACR_2119) | - | 2003883..2004239 (-) | 357 | WP_011676931.1 | hypothetical protein | - |
| LACR_RS10255 (LACR_2120) | - | 2004236..2004757 (-) | 522 | WP_011676932.1 | DUF1642 domain-containing protein | - |
| LACR_RS10260 (LACR_2121) | - | 2004750..2004956 (-) | 207 | WP_011676933.1 | DUF1125 domain-containing protein | - |
| LACR_RS10265 (LACR_2122) | - | 2004970..2005494 (-) | 525 | WP_011676934.1 | hypothetical protein | - |
| LACR_RS10270 (LACR_2123) | - | 2005601..2005840 (-) | 240 | WP_011676935.1 | DUF1031 domain-containing protein | - |
| LACR_RS14620 (LACR_2124) | - | 2005841..2005972 (-) | 132 | WP_257590451.1 | hypothetical protein | - |
| LACR_RS14625 (LACR_2125) | - | 2006007..2006261 (-) | 255 | WP_011676936.1 | hypothetical protein | - |
| LACR_RS10280 (LACR_2126) | - | 2006251..2006472 (-) | 222 | WP_011676937.1 | hypothetical protein | - |
| LACR_RS10285 (LACR_2127) | - | 2006453..2007255 (-) | 803 | Protein_2010 | DnaD domain protein | - |
| LACR_RS10290 (LACR_2128) | ssb | 2007398..2007823 (-) | 426 | WP_011676939.1 | single-stranded DNA-binding protein | Machinery gene |
| LACR_RS10295 (LACR_2129) | - | 2007816..2008574 (-) | 759 | WP_011676940.1 | Rad52/Rad22 family DNA repair protein | - |
| LACR_RS10300 (LACR_2130) | - | 2008583..2008978 (-) | 396 | WP_011676941.1 | hypothetical protein | - |
| LACR_RS10305 (LACR_2131) | - | 2009077..2009313 (-) | 237 | WP_011676942.1 | DUF1408 domain-containing protein | - |
| LACR_RS10310 (LACR_2132) | - | 2009410..2009775 (+) | 366 | WP_063282574.1 | DUF2513 domain-containing protein | - |
| LACR_RS14630 (LACR_2133) | - | 2009763..2010197 (-) | 435 | WP_011676944.1 | hypothetical protein | - |
| LACR_RS10320 (LACR_2134) | - | 2010291..2010560 (-) | 270 | WP_011676945.1 | hypothetical protein | - |
| LACR_RS10325 (LACR_2135) | - | 2010573..2011355 (-) | 783 | WP_011676946.1 | phage repressor protein/antirepressor Ant | - |
| LACR_RS10330 (LACR_2136) | - | 2011368..2011607 (-) | 240 | WP_011676947.1 | helix-turn-helix transcriptional regulator | - |
| LACR_RS10335 (LACR_2137) | - | 2011705..2012214 (+) | 510 | WP_011676948.1 | hypothetical protein | - |
| LACR_RS10345 (LACR_2141) | - | 2012832..2013026 (-) | 195 | WP_011676952.1 | putative transcriptional regulator | - |
| LACR_RS10355 (LACR_2142) | - | 2013289..2013816 (+) | 528 | WP_011676953.1 | helix-turn-helix domain-containing protein | - |
| LACR_RS10360 (LACR_2143) | - | 2013822..2014256 (+) | 435 | WP_011676954.1 | zinc peptidase | - |
| LACR_RS10365 (LACR_2144) | - | 2014270..2014605 (+) | 336 | WP_011676955.1 | hypothetical protein | - |
| LACR_RS10370 (LACR_2145) | - | 2014672..2015853 (+) | 1182 | WP_011676956.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15693.35 Da Isoelectric Point: 5.1972
>NTDB_id=26571 LACR_RS10290 WP_011676939.1 2007398..2007823(-) (ssb) [Lactococcus cremoris subsp. cremoris SK11]
MINNVTLVGRITKEPELRYTQQNKAVASFTLAVNRAFKNANGEREADFINCVIWGKSAENLANWTHKGQLIGVTGSIQTR
NYENQQGQRVYITEVVASNFQVLEKSNQANGERVSNPASKPQNNDSFGSDPMEVSDDDLPF
MINNVTLVGRITKEPELRYTQQNKAVASFTLAVNRAFKNANGEREADFINCVIWGKSAENLANWTHKGQLIGVTGSIQTR
NYENQQGQRVYITEVVASNFQVLEKSNQANGERVSNPASKPQNNDSFGSDPMEVSDDDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=26571 LACR_RS10290 WP_011676939.1 2007398..2007823(-) (ssb) [Lactococcus cremoris subsp. cremoris SK11]
ATGATTAACAATGTCACTCTAGTAGGAAGAATCACTAAAGAACCTGAACTTAGATATACACAACAAAATAAAGCAGTTGC
TTCATTTACTCTTGCAGTTAATCGAGCATTTAAAAATGCTAATGGAGAAAGAGAAGCTGACTTTATCAATTGTGTTATTT
GGGGTAAATCAGCCGAAAACTTGGCCAATTGGACTCATAAAGGTCAATTAATTGGAGTTACTGGTAGTATTCAAACTCGA
AACTATGAGAACCAACAAGGGCAGCGTGTTTATATTACGGAGGTTGTCGCAAGTAATTTCCAAGTACTAGAAAAAAGTAA
TCAAGCAAATGGTGAACGAGTTAGTAATCCAGCTTCAAAACCACAAAATAACGATTCTTTTGGAAGTGATCCAATGGAAG
TTTCAGATGATGACCTACCATTCTAA
ATGATTAACAATGTCACTCTAGTAGGAAGAATCACTAAAGAACCTGAACTTAGATATACACAACAAAATAAAGCAGTTGC
TTCATTTACTCTTGCAGTTAATCGAGCATTTAAAAATGCTAATGGAGAAAGAGAAGCTGACTTTATCAATTGTGTTATTT
GGGGTAAATCAGCCGAAAACTTGGCCAATTGGACTCATAAAGGTCAATTAATTGGAGTTACTGGTAGTATTCAAACTCGA
AACTATGAGAACCAACAAGGGCAGCGTGTTTATATTACGGAGGTTGTCGCAAGTAATTTCCAAGTACTAGAAAAAAGTAA
TCAAGCAAATGGTGAACGAGTTAGTAATCCAGCTTCAAAACCACAAAATAACGATTCTTTTGGAAGTGATCCAATGGAAG
TTTCAGATGATGACCTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
52.353 |
100 |
0.631 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
50.581 |
100 |
0.617 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
42.553 |
100 |
0.426 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
42.553 |
100 |
0.426 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
42.553 |
100 |
0.426 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
42.553 |
100 |
0.426 |
| ssbB/cilA | Streptococcus mitis SK321 |
42.553 |
100 |
0.426 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
57.692 |
73.759 |
0.426 |
| ssbA | Streptococcus mutans UA159 |
39.007 |
100 |
0.39 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
50.485 |
73.05 |
0.369 |