Detailed information NTG0261154

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: SPSF3K_RS01945
• Genome accession: NZ_CP025420
• Coordinates: 408535..408861 (+)
• Length: 108 a.a.
• NCBI ID: WP_004347181.1
• Uniprot ID: A0A0E2UAV4
• Organism: Streptococcus parauberis strain SPOF3K
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 403535..413861

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
SPSF3K_RS01930 (SPSF3K_00399)	-	406202..406576 (+)	375	WP_003108753.1	DUF1033 family protein	-
SPSF3K_RS01935 (SPSF3K_00400)	comYA	406630..407571 (+)	942	WP_003108751.1	competence type IV pilus ATPase ComGA	Machinery gene
SPSF3K_RS01940 (SPSF3K_00401)	comYB	407483..408538 (+)	1056	WP_152414240.1	competence type IV pilus assembly protein ComGB	Machinery gene
SPSF3K_RS01945 (SPSF3K_00402)	comYC	408535..408861 (+)	327	WP_004347181.1	competence type IV pilus major pilin ComGC	Machinery gene
SPSF3K_RS01950 (SPSF3K_00403)	comGD	408851..409258 (+)	408	WP_243619590.1	competence type IV pilus minor pilin ComGD	-
SPSF3K_RS01955 (SPSF3K_00404)	comGE	409230..409529 (+)	300	WP_003108643.1	competence type IV pilus minor pilin ComGE	-
SPSF3K_RS01960 (SPSF3K_00405)	comGF	409507..409944 (+)	438	WP_003102915.1	competence type IV pilus minor pilin ComGF	-
SPSF3K_RS01965 (SPSF3K_00406)	comGG	409922..410419 (+)	498	WP_003108640.1	competence type IV pilus minor pilin ComGG	-
SPSF3K_RS01970 (SPSF3K_00407)	comYH	410526..411482 (+)	957	WP_003103712.1	class I SAM-dependent methyltransferase	Machinery gene
SPSF3K_RS01975 (SPSF3K_00408)	-	411538..412731 (+)	1194	WP_003108638.1	acetate kinase	-
SPSF3K_RS01980 (SPSF3K_00409)	-	412842..413054 (+)	213	WP_003108636.1	helix-turn-helix transcriptional regulator	-
SPSF3K_RS01985 (SPSF3K_00410)	-	413047..413499 (+)	453	WP_003108634.1	hypothetical protein	-

Sequence

Protein

• Length: 108 a.a.
• Molecular weight: 12269.52 Da
• Isoelectric Point: 10.0279

>NTDB_id=261154 SPSF3K_RS01945 WP_004347181.1 408535..408861(+) (comYC) [Streptococcus parauberis strain SPOF3K]
MKKFIINFKNKSVQAFTLLEMLMVILIISILMLLFIPNLNKQKEKVLDTGGEALVKIVENQAELYALNNAGKVPSLNDLK
SNGNLTEKQITAYNDYYKKHSDKIPNVK

Nucleotide

• Length: 327 bp

>NTDB_id=261154 SPSF3K_RS01945 WP_004347181.1 408535..408861(+) (comYC) [Streptococcus parauberis strain SPOF3K]
ATGAAAAAATTTATTATTAATTTTAAAAACAAATCAGTACAAGCATTCACTCTTTTAGAGATGCTAATGGTTATTCTTAT
TATTTCTATACTGATGCTCTTATTTATTCCAAATTTAAACAAACAAAAAGAAAAAGTCTTGGATACCGGAGGAGAGGCTC
TAGTTAAAATAGTTGAAAATCAAGCTGAACTCTATGCATTGAACAATGCTGGCAAAGTGCCATCATTAAATGATTTAAAG
AGCAATGGAAATTTAACAGAAAAGCAAATAACCGCTTATAATGATTATTATAAAAAACACAGTGATAAAATCCCAAATGT
TAAATAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (11-34)

3D structure

• AlphaFold DB: A0A0E2UAV4

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus mutans UA140	57	92.593	0.528
comYC	Streptococcus mutans UA159	57	92.593	0.528
comGC/cglC	Streptococcus mitis SK321	54.455	93.519	0.509
comGC/cglC	Streptococcus mitis NCTC 12261	53	92.593	0.491
comGC/cglC	Streptococcus pneumoniae TIGR4	52.475	93.519	0.491
comGC/cglC	Streptococcus pneumoniae R6	52.475	93.519	0.491
comGC/cglC	Streptococcus pneumoniae D39	52.475	93.519	0.491
comGC/cglC	Streptococcus pneumoniae Rx1	52.475	93.519	0.491
comYC	Streptococcus gordonii str. Challis substr. CH1	55.789	87.963	0.491
comGC	Lactococcus lactis subsp. cremoris KW2	52.083	88.889	0.463
comGC	Staphylococcus aureus MW2	47.561	75.926	0.361
comGC	Staphylococcus aureus N315	47.561	75.926	0.361
comYC	Streptococcus suis isolate S10	48.148	75	0.361