Detailed information NTG0261016

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: CR922_RS08905
• Genome accession: NZ_CP025400
• Coordinates: 1673776..1674102 (-)
• Length: 108 a.a.
• NCBI ID: WP_002946126.1
• Uniprot ID: A0A0E2Q1B3
• Organism: Streptococcus thermophilus strain EPS
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1668776..1679102

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
CR922_RS10535	-	1669043..1669468 (-)	426	WP_041827107.1	CPBP family intramembrane glutamic endopeptidase	-
CR922_RS08870	-	1669711..1669908 (-)	198	WP_011681682.1	helix-turn-helix transcriptional regulator	-
CR922_RS08875	-	1670157..1671350 (-)	1194	WP_022096898.1	acetate kinase	-
CR922_RS08880	comYH	1671406..1672362 (-)	957	WP_011226622.1	class I SAM-dependent methyltransferase	Machinery gene
CR922_RS08885	comGG	1672407..1672724 (-)	318	WP_002952035.1	competence type IV pilus minor pilin ComGG	-
CR922_RS08890	comYF	1672702..1673139 (-)	438	WP_101361359.1	competence type IV pilus minor pilin ComGF	Machinery gene
CR922_RS08895	comGE	1673123..1673416 (-)	294	WP_011226625.1	competence type IV pilus minor pilin ComGE	-
CR922_RS08900	comYD	1673388..1673816 (-)	429	WP_011226626.1	competence type IV pilus minor pilin ComGD	Machinery gene
CR922_RS08905	comYC	1673776..1674102 (-)	327	WP_002946126.1	competence type IV pilus major pilin ComGC	Machinery gene
CR922_RS08910	comYB	1674099..1675199 (-)	1101	WP_148148900.1	competence type IV pilus assembly protein ComGB	Machinery gene
CR922_RS08915	comGA/cglA/cilD	1675081..1676022 (-)	942	WP_011226629.1	competence type IV pilus ATPase ComGA	Machinery gene
CR922_RS08920	-	1676103..1676465 (-)	363	WP_011226630.1	DUF1033 family protein	-

Sequence

Protein

• Length: 108 a.a.
• Molecular weight: 11914.00 Da
• Isoelectric Point: 9.9219

>NTDB_id=261016 CR922_RS08905 WP_002946126.1 1673776..1674102(-) (comYC) [Streptococcus thermophilus strain EPS]
MKLMLKKLNAVKLRAFTLIEMLVVLLIISILLLLFVPNLSKQKDSVKETGNAAVVKVVDSQAELYEMKNNKTASLAALVS
EGQITQKQADSYNDYYAKHGGESRSVAN

Nucleotide

• Length: 327 bp

>NTDB_id=261016 CR922_RS08905 WP_002946126.1 1673776..1674102(-) (comYC) [Streptococcus thermophilus strain EPS]
ATGAAATTGATGTTAAAAAAATTGAATGCCGTTAAATTACGAGCCTTTACTCTGATTGAAATGCTAGTAGTACTTCTCAT
TATCAGTATTCTCCTTTTGCTCTTTGTTCCTAACTTAAGCAAGCAGAAGGATTCCGTTAAGGAAACTGGAAATGCGGCTG
TAGTCAAGGTCGTGGATTCTCAGGCAGAACTTTATGAAATGAAGAATAACAAGACAGCTAGCTTGGCAGCTCTTGTTTCA
GAAGGTCAAATTACGCAAAAACAGGCAGATTCATATAATGATTACTATGCGAAACATGGTGGTGAAAGCCGCTCAGTGGC
CAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (14-34)

3D structure

• AlphaFold DB: A0A0E2Q1B3

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus mutans UA140	69.231	96.296	0.667
comYC	Streptococcus mutans UA159	69.231	96.296	0.667
comYC	Streptococcus gordonii str. Challis substr. CH1	63.81	97.222	0.62
comGC/cglC	Streptococcus mitis SK321	62.264	98.148	0.611
comGC/cglC	Streptococcus mitis NCTC 12261	58.333	100	0.583
comGC/cglC	Streptococcus pneumoniae D39	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae R6	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae Rx1	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae TIGR4	58.491	98.148	0.574
comGC	Lactococcus lactis subsp. cremoris KW2	56.604	98.148	0.556
comYC	Streptococcus suis isolate S10	60.227	81.481	0.491
comGC	Staphylococcus aureus MW2	50	72.222	0.361
comGC	Staphylococcus aureus N315	50	72.222	0.361