Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | CCX84_RS14905 | Genome accession | NZ_CP022345 |
| Coordinates | 2802283..2802618 (-) | Length | 111 a.a. |
| NCBI ID | WP_000982015.1 | Uniprot ID | A0A9X7QJP1 |
| Organism | Bacillus thuringiensis strain c25 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2802283..2858735 | 2802283..2802618 | within | 0 |
Gene organization within MGE regions
Location: 2802283..2858735
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CCX84_RS14905 | ssbA | 2802283..2802618 (-) | 336 | WP_000982015.1 | single-stranded DNA-binding protein | Machinery gene |
| CCX84_RS14910 | - | 2802780..2803034 (-) | 255 | WP_000975131.1 | DUF4318 domain-containing protein | - |
| CCX84_RS14915 | - | 2803139..2803870 (-) | 732 | WP_001260655.1 | Bax inhibitor-1/YccA family protein | - |
| CCX84_RS14920 | - | 2803946..2805841 (-) | 1896 | WP_061139360.1 | ABC-F family ATP-binding cassette domain-containing protein | - |
| CCX84_RS14925 | - | 2805838..2806485 (-) | 648 | WP_000165966.1 | HD domain-containing protein | - |
| CCX84_RS14930 | - | 2806595..2807377 (+) | 783 | WP_000499720.1 | hypothetical protein | - |
| CCX84_RS14935 | - | 2807800..2808015 (-) | 216 | WP_000756629.1 | hypothetical protein | - |
| CCX84_RS14940 | - | 2808012..2809112 (-) | 1101 | WP_172794111.1 | aspartate phosphatase | - |
| CCX84_RS14945 | - | 2809467..2810120 (+) | 654 | WP_061139362.1 | hypothetical protein | - |
| CCX84_RS30470 | - | 2810190..2810405 (+) | 216 | WP_340637552.1 | hypothetical protein | - |
| CCX84_RS14950 | - | 2810472..2811530 (-) | 1059 | WP_061139363.1 | N-acetylmuramoyl-L-alanine amidase | - |
| CCX84_RS14955 | - | 2811610..2812107 (-) | 498 | WP_000439588.1 | phage holin family protein | - |
| CCX84_RS14965 | - | 2812416..2813336 (-) | 921 | WP_061139364.1 | hypothetical protein | - |
| CCX84_RS14970 | - | 2813350..2813733 (-) | 384 | WP_061139365.1 | hypothetical protein | - |
| CCX84_RS14975 | - | 2813743..2815248 (-) | 1506 | WP_232487790.1 | cell adhesion protein | - |
| CCX84_RS14980 | - | 2815230..2817452 (-) | 2223 | WP_061139366.1 | hypothetical protein | - |
| CCX84_RS14985 | - | 2817476..2819203 (-) | 1728 | WP_061139367.1 | hypothetical protein | - |
| CCX84_RS14990 | - | 2819217..2820554 (-) | 1338 | WP_017673857.1 | hypothetical protein | - |
| CCX84_RS14995 | - | 2820568..2820945 (-) | 378 | WP_017673856.1 | hypothetical protein | - |
| CCX84_RS15000 | - | 2820958..2821332 (-) | 375 | WP_061139368.1 | hypothetical protein | - |
| CCX84_RS15005 | - | 2821377..2821760 (-) | 384 | WP_017673854.1 | hypothetical protein | - |
| CCX84_RS15010 | - | 2821771..2823315 (-) | 1545 | WP_061139369.1 | hypothetical protein | - |
| CCX84_RS15015 | - | 2823312..2823995 (-) | 684 | WP_061139370.1 | hypothetical protein | - |
| CCX84_RS15020 | - | 2823992..2825998 (-) | 2007 | WP_061139371.1 | hypothetical protein | - |
| CCX84_RS15025 | - | 2826223..2827155 (-) | 933 | Protein_2870 | phage tail tape measure protein | - |
| CCX84_RS15030 | - | 2827190..2827609 (-) | 420 | WP_061139372.1 | hypothetical protein | - |
| CCX84_RS15035 | - | 2827573..2828091 (-) | 519 | WP_061139373.1 | hypothetical protein | - |
| CCX84_RS15040 | - | 2828151..2828753 (-) | 603 | WP_061139374.1 | hypothetical protein | - |
| CCX84_RS15045 | - | 2828766..2829188 (-) | 423 | WP_000063397.1 | hypothetical protein | - |
| CCX84_RS15050 | - | 2829192..2829602 (-) | 411 | WP_061139375.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| CCX84_RS15055 | - | 2829609..2829980 (-) | 372 | WP_061139376.1 | hypothetical protein | - |
| CCX84_RS15060 | - | 2829977..2830513 (-) | 537 | WP_061139377.1 | hypothetical protein | - |
| CCX84_RS15065 | - | 2830513..2830677 (-) | 165 | WP_000869887.1 | YqbF domain-containing protein | - |
| CCX84_RS15070 | - | 2830848..2831834 (-) | 987 | WP_061139378.1 | phage major capsid protein | - |
| CCX84_RS15075 | - | 2831851..2833053 (-) | 1203 | WP_061139379.1 | XkdF-like putative serine protease domain-containing protein | - |
| CCX84_RS15080 | - | 2833167..2833685 (-) | 519 | WP_061139380.1 | phage minor head protein | - |
| CCX84_RS15085 | - | 2833799..2835277 (-) | 1479 | WP_061139381.1 | phage portal protein | - |
| CCX84_RS15090 | - | 2835347..2836624 (-) | 1278 | WP_061139382.1 | PBSX family phage terminase large subunit | - |
| CCX84_RS15095 | terS | 2836617..2837444 (-) | 828 | WP_061139383.1 | phage terminase small subunit | - |
| CCX84_RS15100 | - | 2837466..2837645 (-) | 180 | WP_061139384.1 | hypothetical protein | - |
| CCX84_RS15105 | - | 2837743..2837964 (+) | 222 | WP_000265602.1 | hypothetical protein | - |
| CCX84_RS15110 | - | 2838095..2838637 (-) | 543 | WP_061139385.1 | site-specific integrase | - |
| CCX84_RS15115 | - | 2839105..2839311 (+) | 207 | WP_061139386.1 | hypothetical protein | - |
| CCX84_RS30995 | - | 2839438..2839560 (-) | 123 | WP_098224024.1 | DNA translocase FtsK | - |
| CCX84_RS15125 | - | 2840015..2840233 (-) | 219 | WP_000930974.1 | hypothetical protein | - |
| CCX84_RS15130 | - | 2840640..2841590 (-) | 951 | WP_061139387.1 | nucleoside hydrolase | - |
| CCX84_RS15135 | - | 2841810..2842352 (-) | 543 | WP_061139388.1 | site-specific integrase | - |
| CCX84_RS15140 | - | 2842327..2842834 (-) | 508 | Protein_2893 | ArpU family phage packaging/lysis transcriptional regulator | - |
| CCX84_RS15155 | - | 2844818..2846107 (+) | 1290 | WP_061139390.1 | hypothetical protein | - |
| CCX84_RS15160 | - | 2847229..2847798 (+) | 570 | WP_001199851.1 | cupin domain-containing protein | - |
| CCX84_RS15170 | - | 2848663..2849049 (-) | 387 | WP_061139391.1 | hypothetical protein | - |
| CCX84_RS15175 | - | 2849572..2849763 (-) | 192 | WP_061139392.1 | DUF3954 domain-containing protein | - |
| CCX84_RS15180 | - | 2849835..2850197 (-) | 363 | WP_001125986.1 | hypothetical protein | - |
| CCX84_RS15185 | - | 2850208..2851191 (-) | 984 | WP_061139393.1 | DnaD domain protein | - |
| CCX84_RS15190 | - | 2851309..2851593 (-) | 285 | WP_061139394.1 | hypothetical protein | - |
| CCX84_RS15195 | - | 2851775..2851996 (-) | 222 | WP_061139395.1 | hypothetical protein | - |
| CCX84_RS15200 | - | 2852027..2852542 (-) | 516 | WP_061139396.1 | helix-turn-helix transcriptional regulator | - |
| CCX84_RS15205 | - | 2852610..2852909 (-) | 300 | WP_061139397.1 | helix-turn-helix domain-containing protein | - |
| CCX84_RS15210 | - | 2852936..2853157 (-) | 222 | WP_061139398.1 | helix-turn-helix transcriptional regulator | - |
| CCX84_RS15215 | - | 2853300..2853644 (+) | 345 | WP_061139399.1 | helix-turn-helix transcriptional regulator | - |
| CCX84_RS15220 | - | 2853734..2854771 (-) | 1038 | WP_061139400.1 | hypothetical protein | - |
| CCX84_RS15225 | - | 2854775..2856115 (-) | 1341 | WP_061139401.1 | ATP-binding protein | - |
| CCX84_RS15235 | - | 2857060..2857578 (+) | 519 | WP_061139402.1 | ImmA/IrrE family metallo-endopeptidase | - |
| CCX84_RS15240 | - | 2857599..2858735 (+) | 1137 | WP_061139403.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 111 a.a. Molecular weight: 12740.60 Da Isoelectric Point: 9.7036
>NTDB_id=238534 CCX84_RS14905 WP_000982015.1 2802283..2802618(-) (ssbA) [Bacillus thuringiensis strain c25]
MMNRVVLIGRLTKEPELYYTKQGVAYARICVAVNRGFRNSLGEQQVDFINCVVWRKSAENVAEYCKKGSLVGITGRIQTS
NYNDEQGKRIYRTEVVIESITFLERRREGAS
MMNRVVLIGRLTKEPELYYTKQGVAYARICVAVNRGFRNSLGEQQVDFINCVVWRKSAENVAEYCKKGSLVGITGRIQTS
NYNDEQGKRIYRTEVVIESITFLERRREGAS
Nucleotide
Download Length: 336 bp
>NTDB_id=238534 CCX84_RS14905 WP_000982015.1 2802283..2802618(-) (ssbA) [Bacillus thuringiensis strain c25]
ATGATGAATCGAGTTGTATTAATCGGTAGATTGACAAAGGAGCCAGAATTATACTACACAAAACAAGGCGTCGCTTATGC
ACGAATATGTGTTGCGGTGAATAGAGGATTTCGAAATAGTTTAGGTGAACAACAAGTCGATTTTATTAATTGTGTCGTTT
GGCGCAAATCGGCTGAGAATGTAGCTGAATATTGTAAGAAGGGGTCGCTCGTTGGGATTACAGGGCGTATTCAGACTAGT
AATTACAATGATGAACAAGGCAAGAGAATATATAGAACTGAAGTTGTGATTGAGAGTATTACCTTTTTGGAGAGAAGGCG
GGAGGGGGCATCGTAA
ATGATGAATCGAGTTGTATTAATCGGTAGATTGACAAAGGAGCCAGAATTATACTACACAAAACAAGGCGTCGCTTATGC
ACGAATATGTGTTGCGGTGAATAGAGGATTTCGAAATAGTTTAGGTGAACAACAAGTCGATTTTATTAATTGTGTCGTTT
GGCGCAAATCGGCTGAGAATGTAGCTGAATATTGTAAGAAGGGGTCGCTCGTTGGGATTACAGGGCGTATTCAGACTAGT
AATTACAATGATGAACAAGGCAAGAGAATATATAGAACTGAAGTTGTGATTGAGAGTATTACCTTTTTGGAGAGAAGGCG
GGAGGGGGCATCGTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
59.434 |
95.495 |
0.568 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
56.604 |
95.495 |
0.541 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
51.786 |
100 |
0.523 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
45.714 |
94.595 |
0.432 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.636 |
99.099 |
0.432 |
| ssbA | Streptococcus mutans UA159 |
40.909 |
99.099 |
0.405 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40.909 |
99.099 |
0.405 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
40.909 |
99.099 |
0.405 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
40 |
99.099 |
0.396 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
40 |
99.099 |
0.396 |
| ssbB/cilA | Streptococcus mitis SK321 |
40 |
99.099 |
0.396 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
40 |
99.099 |
0.396 |