Detailed information NTG0238053

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: CFN12_RS08365
• Genome accession: NZ_CP022290
• Coordinates: 1631985..1632296 (-)
• Length: 103 a.a.
• NCBI ID: WP_100183655.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain EDCC5458
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1626985..1637296

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
CFN12_RS08330 (CFN12_08295)	gcvPA	1627487..1628833 (-)	1347	WP_000019687.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
CFN12_RS08335 (CFN12_08300)	gcvT	1628853..1629944 (-)	1092	WP_000093349.1	glycine cleavage system aminomethyltransferase GcvT	-
CFN12_RS08340 (CFN12_08305)	-	1630103..1630627 (-)	525	WP_100183654.1	shikimate kinase	-
CFN12_RS08345 (CFN12_08310)	-	1630617..1630763 (-)	147	WP_001789879.1	hypothetical protein	-
CFN12_RS08350 (CFN12_08315)	comGF	1630860..1631357 (-)	498	WP_001789864.1	competence type IV pilus minor pilin ComGF	Machinery gene
CFN12_RS08355 (CFN12_08320)	comGE	1631275..1631574 (-)	300	WP_000844413.1	hypothetical protein	Machinery gene
CFN12_RS08360 (CFN12_08325)	comGD	1631561..1632007 (-)	447	WP_001790850.1	competence type IV pilus minor pilin ComGD	Machinery gene
CFN12_RS08365 (CFN12_08330)	comGC	1631985..1632296 (-)	312	WP_100183655.1	competence type IV pilus major pilin ComGC	Machinery gene
CFN12_RS08370 (CFN12_08335)	comGB	1632310..1633380 (-)	1071	WP_000775708.1	competence type IV pilus assembly protein ComGB	Machinery gene
CFN12_RS08375 (CFN12_08340)	comGA	1633352..1634326 (-)	975	WP_054104768.1	competence type IV pilus ATPase ComGA	Machinery gene
CFN12_RS08380 (CFN12_08345)	-	1634378..1635001 (-)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
CFN12_RS08385 (CFN12_08350)	-	1634998..1635327 (-)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
CFN12_RS08390 (CFN12_08355)	-	1635327..1636313 (-)	987	WP_000161314.1	ROK family glucokinase	-
CFN12_RS08395 (CFN12_08360)	-	1636310..1636513 (-)	204	WP_000087561.1	YqgQ family protein	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11327.41 Da
• Isoelectric Point: 8.5268

>NTDB_id=238053 CFN12_RS08365 WP_100183655.1 1631985..1632296(-) (comGC) [Staphylococcus aureus strain EDCC5458]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGEIITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=238053 CFN12_RS08365 WP_100183655.1 1631985..1632296(-) (comGC) [Staphylococcus aureus strain EDCC5458]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGATAATCACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	99.029	100	0.99
comGC	Staphylococcus aureus N315	99.029	100	0.99
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comGC/cglC	Streptococcus pneumoniae Rx1	50	83.495	0.417
comGC/cglC	Streptococcus pneumoniae R6	50	83.495	0.417
comGC/cglC	Streptococcus pneumoniae D39	50	83.495	0.417
comGC/cglC	Streptococcus pneumoniae TIGR4	50	83.495	0.417
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369