Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | CEQ16_RS11525 | Genome accession | NZ_CP022059 |
| Coordinates | 2209793..2210068 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain FDAARGOS_338 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2170001..2228175 | 2209793..2210068 | within | 0 |
Gene organization within MGE regions
Location: 2170001..2228175
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CEQ16_RS11225 (CEQ16_11195) | - | 2170001..2171008 (-) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| CEQ16_RS11230 (CEQ16_11200) | comGG | 2171137..2171490 (-) | 354 | WP_002381743.1 | competence type IV pilus minor pilin ComGG | - |
| CEQ16_RS11235 (CEQ16_11205) | comGF | 2171490..2171924 (-) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| CEQ16_RS11240 (CEQ16_11210) | - | 2171914..2172285 (-) | 372 | WP_170310356.1 | type II secretion system protein | - |
| CEQ16_RS11250 (CEQ16_11220) | hemH | 2173040..2173981 (-) | 942 | WP_002357056.1 | ferrochelatase | - |
| CEQ16_RS11260 (CEQ16_11230) | - | 2174697..2174969 (-) | 273 | WP_002378444.1 | hypothetical protein | - |
| CEQ16_RS11265 (CEQ16_11235) | - | 2175041..2175241 (-) | 201 | WP_002357053.1 | cold-shock protein | - |
| CEQ16_RS11270 (CEQ16_11240) | - | 2176088..2177347 (-) | 1260 | WP_002381740.1 | LysM peptidoglycan-binding domain-containing protein | - |
| CEQ16_RS11275 (CEQ16_11245) | - | 2177360..2177740 (-) | 381 | WP_002378446.1 | phage holin family protein | - |
| CEQ16_RS11280 (CEQ16_11250) | - | 2177751..2177873 (-) | 123 | WP_002368228.1 | XkdX family protein | - |
| CEQ16_RS11285 (CEQ16_11255) | - | 2177875..2178270 (-) | 396 | WP_002363385.1 | hypothetical protein | - |
| CEQ16_RS11290 (CEQ16_11260) | - | 2178289..2178741 (-) | 453 | WP_002363384.1 | hypothetical protein | - |
| CEQ16_RS11295 (CEQ16_11265) | - | 2178758..2179498 (-) | 741 | WP_002363383.1 | hypothetical protein | - |
| CEQ16_RS11300 (CEQ16_11270) | - | 2179504..2180949 (-) | 1446 | WP_002378447.1 | phage tail spike protein | - |
| CEQ16_RS11305 (CEQ16_11275) | - | 2180949..2181671 (-) | 723 | WP_002363380.1 | hypothetical protein | - |
| CEQ16_RS11310 (CEQ16_11280) | - | 2181668..2186122 (-) | 4455 | WP_002398616.1 | phage tail tape measure protein | - |
| CEQ16_RS11315 (CEQ16_11285) | - | 2186109..2186414 (-) | 306 | WP_002364305.1 | hypothetical protein | - |
| CEQ16_RS11320 (CEQ16_11290) | - | 2186483..2186881 (-) | 399 | WP_002363376.1 | tail assembly chaperone | - |
| CEQ16_RS11325 (CEQ16_11295) | - | 2186944..2187252 (-) | 309 | WP_002381737.1 | hypothetical protein | - |
| CEQ16_RS11330 (CEQ16_11300) | - | 2187255..2187860 (-) | 606 | WP_002381736.1 | phage major tail protein, TP901-1 family | - |
| CEQ16_RS11335 (CEQ16_11305) | - | 2187880..2188272 (-) | 393 | WP_002381735.1 | hypothetical protein | - |
| CEQ16_RS11340 (CEQ16_11310) | - | 2188269..2188607 (-) | 339 | WP_002381734.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| CEQ16_RS11345 (CEQ16_11315) | - | 2188604..2188879 (-) | 276 | WP_002364301.1 | hypothetical protein | - |
| CEQ16_RS11350 (CEQ16_11320) | - | 2188876..2189208 (-) | 333 | WP_002363369.1 | phage head-tail connector protein | - |
| CEQ16_RS11355 (CEQ16_11325) | - | 2189279..2190175 (-) | 897 | WP_002381733.1 | hypothetical protein | - |
| CEQ16_RS11360 (CEQ16_11330) | - | 2190188..2190823 (-) | 636 | WP_010717040.1 | DUF4355 domain-containing protein | - |
| CEQ16_RS11365 (CEQ16_11335) | - | 2190946..2191872 (-) | 927 | WP_002363365.1 | minor capsid protein | - |
| CEQ16_RS11370 (CEQ16_11340) | - | 2191865..2193349 (-) | 1485 | WP_002381731.1 | phage portal protein | - |
| CEQ16_RS11375 (CEQ16_11345) | - | 2193349..2194632 (-) | 1284 | WP_002381730.1 | PBSX family phage terminase large subunit | - |
| CEQ16_RS11380 (CEQ16_11350) | - | 2194613..2195047 (-) | 435 | WP_002364295.1 | terminase small subunit | - |
| CEQ16_RS11385 (CEQ16_11355) | - | 2195079..2195309 (-) | 231 | WP_002400650.1 | hypothetical protein | - |
| CEQ16_RS14955 | - | 2195681..2195815 (-) | 135 | WP_263970730.1 | hypothetical protein | - |
| CEQ16_RS11395 (CEQ16_11365) | - | 2196295..2197269 (-) | 975 | WP_010773995.1 | DUF6731 family protein | - |
| CEQ16_RS11410 (CEQ16_11380) | - | 2197986..2198402 (-) | 417 | WP_002357018.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| CEQ16_RS11420 (CEQ16_11390) | - | 2199310..2199744 (-) | 435 | WP_002357016.1 | RusA family crossover junction endodeoxyribonuclease | - |
| CEQ16_RS11425 (CEQ16_11395) | - | 2199753..2200052 (-) | 300 | WP_002357015.1 | MazG-like family protein | - |
| CEQ16_RS11430 (CEQ16_11400) | - | 2200053..2200355 (-) | 303 | WP_002381727.1 | hypothetical protein | - |
| CEQ16_RS11435 (CEQ16_11405) | - | 2200359..2201240 (-) | 882 | WP_002381726.1 | helix-turn-helix domain-containing protein | - |
| CEQ16_RS11440 (CEQ16_11410) | - | 2201240..2201440 (-) | 201 | WP_002357010.1 | hypothetical protein | - |
| CEQ16_RS11445 (CEQ16_11415) | - | 2201445..2202086 (-) | 642 | WP_002364344.1 | putative HNHc nuclease | - |
| CEQ16_RS11450 (CEQ16_11420) | - | 2202091..2202825 (-) | 735 | WP_002381724.1 | ERF family protein | - |
| CEQ16_RS11455 (CEQ16_11425) | - | 2202909..2203136 (-) | 228 | WP_002381723.1 | hypothetical protein | - |
| CEQ16_RS11460 (CEQ16_11435) | - | 2203356..2203910 (+) | 555 | WP_002357006.1 | hypothetical protein | - |
| CEQ16_RS14905 | - | 2204337..2204531 (-) | 195 | WP_002381722.1 | hypothetical protein | - |
| CEQ16_RS11475 (CEQ16_11450) | - | 2204568..2204777 (-) | 210 | WP_002381721.1 | hypothetical protein | - |
| CEQ16_RS11480 (CEQ16_11455) | - | 2204832..2205020 (+) | 189 | WP_002357001.1 | YegP family protein | - |
| CEQ16_RS11485 (CEQ16_11460) | - | 2205046..2205771 (-) | 726 | WP_002381720.1 | phage regulatory protein | - |
| CEQ16_RS11490 (CEQ16_11465) | - | 2205810..2206121 (-) | 312 | WP_002381719.1 | hypothetical protein | - |
| CEQ16_RS11495 (CEQ16_11470) | - | 2206132..2206308 (-) | 177 | WP_002364354.1 | helix-turn-helix transcriptional regulator | - |
| CEQ16_RS11500 (CEQ16_11475) | - | 2206620..2206952 (+) | 333 | WP_002364355.1 | helix-turn-helix domain-containing protein | - |
| CEQ16_RS11505 (CEQ16_11480) | - | 2206969..2207313 (+) | 345 | WP_002381718.1 | ImmA/IrrE family metallo-endopeptidase | - |
| CEQ16_RS11510 (CEQ16_11485) | - | 2207349..2208077 (+) | 729 | WP_002381717.1 | potassium channel family protein | - |
| CEQ16_RS11515 (CEQ16_11490) | - | 2208177..2209325 (+) | 1149 | WP_002381716.1 | site-specific integrase | - |
| CEQ16_RS11520 (CEQ16_11495) | comGD | 2209353..2209796 (-) | 444 | WP_002381715.1 | competence type IV pilus minor pilin ComGD | - |
| CEQ16_RS11525 (CEQ16_11500) | comGC/cglC | 2209793..2210068 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| CEQ16_RS11530 (CEQ16_11505) | comGB | 2210068..2211114 (-) | 1047 | WP_002356990.1 | competence type IV pilus assembly protein ComGB | - |
| CEQ16_RS11535 (CEQ16_11510) | comGA | 2211071..2212039 (-) | 969 | WP_002364362.1 | competence type IV pilus ATPase ComGA | - |
| CEQ16_RS11540 (CEQ16_11515) | - | 2212280..2213608 (-) | 1329 | WP_002356988.1 | APC family permease | - |
| CEQ16_RS11550 (CEQ16_11525) | rlmN | 2213898..2214971 (-) | 1074 | WP_002381713.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
| CEQ16_RS11555 (CEQ16_11530) | - | 2215097..2216926 (-) | 1830 | WP_002398606.1 | ABC transporter permease | - |
| CEQ16_RS11560 (CEQ16_11535) | - | 2216916..2217665 (-) | 750 | WP_002381711.1 | ABC transporter ATP-binding protein | - |
| CEQ16_RS11565 (CEQ16_11540) | - | 2217783..2218484 (-) | 702 | WP_002364244.1 | GntR family transcriptional regulator | - |
| CEQ16_RS11570 (CEQ16_11545) | - | 2218615..2221038 (-) | 2424 | WP_002380448.1 | DNA translocase FtsK | - |
| CEQ16_RS11580 (CEQ16_11555) | - | 2221352..2222563 (-) | 1212 | WP_002380449.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| CEQ16_RS11585 (CEQ16_11560) | - | 2222592..2223497 (-) | 906 | WP_002360016.1 | prenyltransferase | - |
| CEQ16_RS11590 (CEQ16_11565) | - | 2223619..2224599 (+) | 981 | WP_002360015.1 | polyprenyl synthetase family protein | - |
| CEQ16_RS11595 (CEQ16_11570) | cydC | 2224679..2226445 (-) | 1767 | WP_002381710.1 | thiol reductant ABC exporter subunit CydC | - |
| CEQ16_RS11600 (CEQ16_11575) | cydD | 2226442..2228175 (-) | 1734 | WP_002381709.1 | thiol reductant ABC exporter subunit CydD | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=236321 CEQ16_RS11525 WP_002356991.1 2209793..2210068(-) (comGC/cglC) [Enterococcus faecalis strain FDAARGOS_338]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=236321 CEQ16_RS11525 WP_002356991.1 2209793..2210068(-) (comGC/cglC) [Enterococcus faecalis strain FDAARGOS_338]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |