Detailed information NTG0230778

Bioinformatically predicted

Overview

• Name: ssbA
• Type: Machinery gene
• Locus tag: BtSCAC15_RS11380
• Genome accession: NZ_CP021436
• Coordinates: 2178282..2178617 (+)
• Length: 111 a.a.
• NCBI ID: WP_000982017.1
• Uniprot ID: A0A9W5L6E7
• Organism: Bacillus thuringiensis strain C15
• Function: ssDNA binding (predicted from homology) DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Prophage	2168798..2178617	2178282..2178617	within	0

Gene organization within MGE regions

Location: 2168798..2178617

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
BtSCAC15_RS11335 (BtSCAC15_11615)	-	2168798..2170585 (-)	1788	WP_236828923.1	tyrosine-type recombinase/integrase	-
BtSCAC15_RS11340 (BtSCAC15_11620)	-	2170582..2171679 (-)	1098	WP_061529146.1	tyrosine-type recombinase/integrase	-
BtSCAC15_RS11345 (BtSCAC15_11625)	-	2172057..2173130 (+)	1074	WP_000109854.1	tetratricopeptide repeat protein	-
BtSCAC15_RS11350 (BtSCAC15_11630)	-	2173127..2173252 (+)	126	WP_000709201.1	aspartate phosphatase	-
BtSCAC15_RS11355 (BtSCAC15_11635)	-	2173549..2174286 (-)	738	WP_000499731.1	hypothetical protein	-
BtSCAC15_RS11360 (BtSCAC15_11640)	-	2174396..2175043 (+)	648	WP_000165966.1	HD domain-containing protein	-
BtSCAC15_RS11365 (BtSCAC15_11645)	-	2175040..2176953 (+)	1914	WP_127063929.1	ABC-F family ATP-binding cassette domain-containing protein	-
BtSCAC15_RS11370 (BtSCAC15_11650)	-	2177029..2177760 (+)	732	WP_001260655.1	Bax inhibitor-1/YccA family protein	-
BtSCAC15_RS11375 (BtSCAC15_11655)	-	2177866..2178120 (+)	255	WP_000975138.1	DUF4318 domain-containing protein	-
BtSCAC15_RS11380 (BtSCAC15_11660)	ssbA	2178282..2178617 (+)	336	WP_000982017.1	single-stranded DNA-binding protein	Machinery gene

Sequence

Protein

• Length: 111 a.a.
• Molecular weight: 12797.69 Da
• Isoelectric Point: 9.4344

>NTDB_id=230778 BtSCAC15_RS11380 WP_000982017.1 2178282..2178617(+) (ssbA) [Bacillus thuringiensis strain C15]
MMNRVVLIGRLTKEPELYYTKQGVAYARICVAVNRGFRNSLGEQQVDFINCVVWRKSAENVTEYCKKGSLVGITGRIQTS
NYDDEQGKRIYRTEVVIESITFLERRREGAL

Nucleotide

• Length: 336 bp

>NTDB_id=230778 BtSCAC15_RS11380 WP_000982017.1 2178282..2178617(+) (ssbA) [Bacillus thuringiensis strain C15]
ATGATGAATCGAGTTGTATTAATCGGTAGATTGACAAAGGAGCCAGAATTATACTACACAAAACAAGGCGTCGCTTATGC
ACGAATATGTGTTGCGGTGAATAGAGGATTTCGAAATAGTTTAGGTGAACAACAAGTCGATTTTATTAATTGTGTCGTTT
GGCGCAAATCGGCTGAGAATGTAACTGAATATTGTAAGAAGGGGTCGCTCGTTGGGATTACAGGGCGTATTCAGACTAGT
AATTACGATGATGAACAAGGCAAGAGAATATATAGAACTGAAGTTGTGATTGAGAGTATTACCTTTTTGGAGAGAAGGCG
GGAGGGGGCATTGTAA

Domains

Predicted by InterproScan.

• Single-strand binding protein family (SSB) (2-103)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
ssbA	Bacillus subtilis subsp. subtilis str. 168	58.491	95.495	0.559
ssb	Latilactobacillus sakei subsp. sakei 23K	55.66	95.495	0.532
ssbB	Bacillus subtilis subsp. subtilis str. 168	51.351	100	0.514
ssbB	Lactococcus lactis subsp. cremoris KW2	45.455	99.099	0.45
ssbB	Streptococcus sobrinus strain NIDR 6715-7	44.144	100	0.441
ssbA	Streptococcus mutans UA159	39.64	100	0.396
ssbB/cilA	Streptococcus mitis NCTC 12261	39.64	100	0.396
ssbB/cilA	Streptococcus pneumoniae TIGR4	39.64	100	0.396
ssbB/cilA	Streptococcus pneumoniae D39	38.739	100	0.387
ssbB/cilA	Streptococcus pneumoniae R6	38.739	100	0.387
ssbB/cilA	Streptococcus mitis SK321	38.739	100	0.387
ssbB/cilA	Streptococcus pneumoniae Rx1	38.739	100	0.387