Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | EF_RS09765 | Genome accession | NC_004668 |
| Coordinates | 1962953..1963228 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis V583 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1920604..1981335 | 1962953..1963228 | within | 0 |
Gene organization within MGE regions
Location: 1920604..1981335
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EF_RS09480 (EF1985) | comGG | 1921518..1921871 (-) | 354 | WP_002357061.1 | competence type IV pilus minor pilin ComGG | - |
| EF_RS09485 (EF1986) | comGF | 1921871..1922305 (-) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| EF_RS09490 (EF1987) | - | 1922295..1922696 (-) | 402 | WP_002383134.1 | type II secretion system protein | - |
| EF_RS16950 (EF1988) | - | 1923000..1923125 (+) | 126 | WP_002364184.1 | hypothetical protein | - |
| EF_RS09495 (EF1989) | hemH | 1923422..1924363 (-) | 942 | WP_002364185.1 | ferrochelatase | - |
| EF_RS09505 (EF1990) | - | 1925103..1925351 (-) | 249 | WP_002383136.1 | hypothetical protein | - |
| EF_RS09510 (EF1991) | - | 1925423..1925623 (-) | 201 | WP_002357053.1 | cold-shock protein | - |
| EF_RS09515 (EF1992) | - | 1926460..1927701 (-) | 1242 | WP_002370962.1 | LysM peptidoglycan-binding domain-containing protein | - |
| EF_RS09520 (EF1993) | - | 1927702..1927935 (-) | 234 | WP_002384371.1 | phage holin | - |
| EF_RS09525 | - | 1927928..1928149 (-) | 222 | WP_002364191.1 | hypothetical protein | - |
| EF_RS09530 (EF1994) | - | 1928184..1928339 (-) | 156 | WP_002364192.1 | XkdX family protein | - |
| EF_RS09535 (EF1995) | - | 1928341..1928661 (-) | 321 | WP_002389262.1 | hypothetical protein | - |
| EF_RS09540 (EF1996) | - | 1928675..1929166 (-) | 492 | WP_002364194.1 | hypothetical protein | - |
| EF_RS09545 | - | 1929166..1929453 (-) | 288 | WP_002357046.1 | collagen-like protein | - |
| EF_RS09550 (EF1998) | - | 1929450..1930046 (-) | 597 | WP_002357045.1 | hypothetical protein | - |
| EF_RS09555 (EF2000) | - | 1930039..1930921 (-) | 883 | Protein_1879 | phage baseplate upper protein | - |
| EF_RS09560 (EF2001) | - | 1930940..1933747 (-) | 2808 | WP_002387289.1 | phage tail spike protein | - |
| EF_RS09565 (EF2002) | - | 1933729..1934463 (-) | 735 | WP_011109514.1 | tail protein | - |
| EF_RS09570 (EF2003) | - | 1934453..1937350 (-) | 2898 | WP_002387288.1 | tape measure protein | - |
| EF_RS09575 (EF2004) | - | 1937598..1937948 (-) | 351 | WP_002357039.1 | phage tail assembly chaperone G | - |
| EF_RS09580 (EF2005) | - | 1938001..1938849 (-) | 849 | WP_002387287.1 | major tail protein | - |
| EF_RS09585 (EF2006) | - | 1938850..1939224 (-) | 375 | WP_002387286.1 | phage tail terminator family protein | - |
| EF_RS09590 (EF2007) | - | 1939227..1939625 (-) | 399 | WP_002357036.1 | HK97 gp10 family phage protein | - |
| EF_RS09595 (EF2008) | - | 1939618..1939992 (-) | 375 | WP_002387285.1 | hypothetical protein | - |
| EF_RS09600 (EF2009) | - | 1939989..1940333 (-) | 345 | WP_002387282.1 | hypothetical protein | - |
| EF_RS09605 (EF2010) | - | 1940347..1940529 (-) | 183 | WP_002387281.1 | hypothetical protein | - |
| EF_RS09610 (EF2011) | - | 1940558..1941445 (-) | 888 | WP_002387280.1 | DUF5309 domain-containing protein | - |
| EF_RS09615 (EF2012) | - | 1941459..1942082 (-) | 624 | WP_010706493.1 | DUF4355 domain-containing protein | - |
| EF_RS09620 (EF2013) | - | 1942301..1942621 (-) | 321 | WP_002380436.1 | hypothetical protein | - |
| EF_RS09625 (EF2014) | - | 1942678..1942908 (-) | 231 | WP_002380437.1 | hypothetical protein | - |
| EF_RS09630 (EF2015) | - | 1942909..1944813 (-) | 1905 | WP_010706494.1 | head protein | - |
| EF_RS09635 (EF2016) | - | 1944788..1946260 (-) | 1473 | WP_010706495.1 | phage portal protein | - |
| EF_RS09640 (EF2017) | terL | 1946272..1947660 (-) | 1389 | WP_002387276.1 | phage terminase large subunit | - |
| EF_RS09645 (EF2018) | - | 1947653..1948114 (-) | 462 | WP_002383816.1 | helix-turn-helix domain-containing protein | - |
| EF_RS09650 (EF2019) | - | 1948190..1948366 (-) | 177 | WP_010706496.1 | hypothetical protein | - |
| EF_RS09655 (EF2020) | - | 1948550..1949362 (-) | 813 | WP_002383813.1 | hypothetical protein | - |
| EF_RS16590 (EF2021) | - | 1949474..1949707 (-) | 234 | Protein_1900 | hypothetical protein | - |
| EF_RS09660 | - | 1950515..1950760 (-) | 246 | WP_010716537.1 | hypothetical protein | - |
| EF_RS09665 (EF2022) | - | 1950785..1951708 (-) | 924 | WP_002383810.1 | DUF6731 family protein | - |
| EF_RS09675 (EF2024) | - | 1952426..1952842 (-) | 417 | WP_010706497.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| EF_RS09680 (EF2026) | - | 1953750..1954158 (-) | 409 | Protein_1904 | RusA family crossover junction endodeoxyribonuclease | - |
| EF_RS09685 (EF2027) | - | 1954155..1955012 (-) | 858 | WP_002387271.1 | helix-turn-helix domain-containing protein | - |
| EF_RS09690 (EF2028) | - | 1955012..1955212 (-) | 201 | WP_002357010.1 | hypothetical protein | - |
| EF_RS16815 | - | 1955217..1955600 (-) | 384 | WP_002383802.1 | putative HNHc nuclease | - |
| EF_RS16820 | - | 1955639..1955857 (-) | 219 | WP_010774222.1 | hypothetical protein | - |
| EF_RS09700 (EF2031) | - | 1955862..1956596 (-) | 735 | WP_002383799.1 | ERF family protein | - |
| EF_RS09705 (EF2032) | - | 1956589..1956906 (-) | 318 | WP_002383798.1 | hypothetical protein | - |
| EF_RS09710 (EF2034) | - | 1957102..1957440 (-) | 339 | WP_002383796.1 | hypothetical protein | - |
| EF_RS09715 | - | 1957477..1957686 (-) | 210 | WP_002378465.1 | hypothetical protein | - |
| EF_RS09720 (EF2036) | - | 1957741..1957929 (+) | 189 | WP_002357001.1 | YegP family protein | - |
| EF_RS09725 (EF2037) | - | 1957955..1958677 (-) | 723 | WP_002387270.1 | Rha family transcriptional regulator | - |
| EF_RS09730 (EF2038) | - | 1958700..1959011 (-) | 312 | WP_002403885.1 | hypothetical protein | - |
| EF_RS09735 (EF2039) | - | 1959023..1959214 (-) | 192 | WP_002383936.1 | hypothetical protein | - |
| EF_RS09740 (EF2040) | - | 1959510..1959851 (+) | 342 | WP_002387267.1 | helix-turn-helix domain-containing protein | - |
| EF_RS09745 (EF2041) | - | 1959856..1960506 (+) | 651 | WP_002387266.1 | ImmA/IrrE family metallo-endopeptidase | - |
| EF_RS09750 (EF2042) | - | 1960602..1961231 (+) | 630 | WP_002387265.1 | SHOCT domain-containing protein | - |
| EF_RS09755 (EF2043) | - | 1961337..1962485 (+) | 1149 | WP_002387264.1 | tyrosine-type recombinase/integrase | - |
| EF_RS09760 | comGD | 1962522..1962956 (-) | 435 | Protein_1921 | competence type IV pilus minor pilin ComGD | - |
| EF_RS09765 (EF2044) | comGC/cglC | 1962953..1963228 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| EF_RS09770 (EF2045) | comGB | 1963228..1964274 (-) | 1047 | WP_002356990.1 | competence type IV pilus assembly protein ComGB | - |
| EF_RS09775 (EF2046) | comGA | 1964231..1965199 (-) | 969 | WP_002364362.1 | competence type IV pilus ATPase ComGA | - |
| EF_RS09780 (EF2047) | - | 1965440..1966768 (-) | 1329 | WP_002362058.1 | APC family permease | - |
| EF_RS09785 (EF2048) | rlmN | 1967059..1968132 (-) | 1074 | WP_002356987.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
| EF_RS09790 (EF2049) | - | 1968257..1970086 (-) | 1830 | WP_002383725.1 | ABC transporter permease | - |
| EF_RS09795 (EF2050) | - | 1970076..1970825 (-) | 750 | WP_002381711.1 | ABC transporter ATP-binding protein | - |
| EF_RS09800 (EF2051) | - | 1970943..1971644 (-) | 702 | WP_002364244.1 | GntR family transcriptional regulator | - |
| EF_RS09805 (EF2052) | - | 1971775..1974198 (-) | 2424 | WP_002364367.1 | DNA translocase FtsK | - |
| EF_RS09810 (EF2055) | - | 1974512..1975723 (-) | 1212 | WP_002360017.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| EF_RS09815 (EF2056) | - | 1975752..1976657 (-) | 906 | WP_002360016.1 | prenyltransferase | - |
| EF_RS09820 (EF2057) | - | 1976779..1977759 (+) | 981 | WP_002360015.1 | polyprenyl synthetase family protein | - |
| EF_RS09825 (EF2058) | cydC | 1977839..1979605 (-) | 1767 | WP_002383727.1 | thiol reductant ABC exporter subunit CydC | - |
| EF_RS09830 (EF2059) | cydD | 1979602..1981335 (-) | 1734 | WP_002378477.1 | thiol reductant ABC exporter subunit CydD | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=22886 EF_RS09765 WP_002356991.1 1962953..1963228(-) (comGC/cglC) [Enterococcus faecalis V583]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=22886 EF_RS09765 WP_002356991.1 1962953..1963228(-) (comGC/cglC) [Enterococcus faecalis V583]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |