Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | SPYM18_RS07730 | Genome accession | NC_003485 |
| Coordinates | 1483437..1483856 (-) | Length | 139 a.a. |
| NCBI ID | WP_011018140.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes MGAS8232 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1451844..1493373 | 1483437..1483856 | within | 0 |
Gene organization within MGE regions
Location: 1451844..1493373
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SPYM18_RS07505 (spyM18_1745) | prx | 1451844..1452026 (-) | 183 | WP_011018104.1 | hypothetical protein | Regulator |
| SPYM18_RS07510 (spyM18_1746) | sda | 1452266..1453264 (+) | 999 | WP_011018105.1 | streptodornase A | - |
| SPYM18_RS07515 (spyM18_1747) | - | 1453405..1453965 (-) | 561 | WP_011018106.1 | GNAT family N-acetyltransferase | - |
| SPYM18_RS07520 (spyM18_1749) | - | 1453998..1454162 (-) | 165 | WP_021340366.1 | hypothetical protein | - |
| SPYM18_RS07525 (spyM18_1750) | - | 1454311..1455516 (-) | 1206 | WP_011018108.1 | glucosaminidase domain-containing protein | - |
| SPYM18_RS07535 | - | 1455629..1455823 (-) | 195 | WP_023079604.1 | hypothetical protein | - |
| SPYM18_RS07540 (spyM18_1753) | - | 1455820..1456119 (-) | 300 | WP_011018110.1 | hypothetical protein | - |
| SPYM18_RS07545 (spyM18_1754) | - | 1456130..1456747 (-) | 618 | WP_011018111.1 | DUF1366 domain-containing protein | - |
| SPYM18_RS07550 (spyM18_1755) | - | 1456750..1457178 (-) | 429 | WP_011018112.1 | DUF1617 family protein | - |
| SPYM18_RS07555 (spyM18_1756) | - | 1457190..1459205 (-) | 2016 | WP_011018113.1 | gp58-like family protein | - |
| SPYM18_RS07560 (spyM18_1757) | - | 1459220..1460329 (-) | 1110 | WP_011018114.1 | hyaluronoglucosaminidase | - |
| SPYM18_RS07565 | - | 1460329..1462308 (-) | 1980 | WP_041174241.1 | phage tail spike protein | - |
| SPYM18_RS10775 (spyM18_1761) | - | 1462316..1462474 (-) | 159 | WP_011018115.1 | hypothetical protein | - |
| SPYM18_RS07570 (spyM18_1762) | - | 1462471..1463187 (-) | 717 | WP_011018116.1 | distal tail protein Dit | - |
| SPYM18_RS07575 (spyM18_1763) | - | 1463184..1466444 (-) | 3261 | WP_011018117.1 | tape measure protein | - |
| SPYM18_RS07580 (spyM18_1764) | - | 1466434..1467015 (-) | 582 | WP_011018118.1 | bacteriophage Gp15 family protein | - |
| SPYM18_RS07585 (spyM18_1765) | - | 1467019..1467453 (-) | 435 | WP_011018119.1 | hypothetical protein | - |
| SPYM18_RS07590 (spyM18_1766) | - | 1467497..1467958 (-) | 462 | WP_011018120.1 | phage tail tube protein | - |
| SPYM18_RS07595 (spyM18_1767) | - | 1467958..1468356 (-) | 399 | WP_011018121.1 | minor capsid protein | - |
| SPYM18_RS07600 (spyM18_1769) | - | 1468353..1468709 (-) | 357 | WP_010922083.1 | minor capsid protein | - |
| SPYM18_RS07605 (spyM18_1770) | - | 1468709..1469041 (-) | 333 | WP_010922082.1 | minor capsid protein | - |
| SPYM18_RS07610 (spyM18_1771) | - | 1469031..1469447 (-) | 417 | WP_011018123.1 | hypothetical protein | - |
| SPYM18_RS07615 (spyM18_1772) | - | 1469501..1470319 (-) | 819 | WP_010922080.1 | N4-gp56 family major capsid protein | - |
| SPYM18_RS07620 (spyM18_1774) | - | 1470323..1470937 (-) | 615 | WP_010922079.1 | hypothetical protein | - |
| SPYM18_RS07625 (spyM18_1775) | - | 1471063..1471329 (-) | 267 | WP_010922078.1 | hypothetical protein | - |
| SPYM18_RS07630 (spyM18_1776) | - | 1471416..1471643 (-) | 228 | WP_010922077.1 | hypothetical protein | - |
| SPYM18_RS07635 (spyM18_1777) | - | 1471643..1473136 (-) | 1494 | WP_011018124.1 | phage minor capsid protein | - |
| SPYM18_RS07640 (spyM18_1778) | - | 1473141..1474643 (-) | 1503 | WP_011184804.1 | phage portal protein | - |
| SPYM18_RS07645 (spyM18_1779) | - | 1474657..1475948 (-) | 1292 | Protein_1485 | PBSX family phage terminase large subunit | - |
| SPYM18_RS07650 (spyM18_1780) | - | 1475951..1476424 (-) | 474 | WP_011018127.1 | hypothetical protein | - |
| SPYM18_RS07655 (spyM18_1781) | - | 1476475..1476852 (-) | 378 | WP_002986841.1 | ASCH domain-containing protein | - |
| SPYM18_RS10005 (spyM18_1782) | - | 1476913..1477389 (-) | 477 | WP_174148345.1 | GNAT family N-acetyltransferase | - |
| SPYM18_RS07665 (spyM18_1783) | - | 1477305..1477982 (-) | 678 | WP_011018129.1 | ABC transporter ATP-binding protein | - |
| SPYM18_RS07670 (spyM18_1784) | - | 1477961..1478479 (-) | 519 | WP_011018130.1 | ParB N-terminal domain-containing protein | - |
| SPYM18_RS07675 (spyM18_1785) | - | 1478943..1479383 (-) | 441 | WP_002990052.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| SPYM18_RS07680 (spyM18_1786) | - | 1479657..1479923 (-) | 267 | WP_011018131.1 | hypothetical protein | - |
| SPYM18_RS07685 (spyM18_1787) | - | 1479920..1480291 (-) | 372 | WP_011018132.1 | DUF1642 domain-containing protein | - |
| SPYM18_RS07690 (spyM18_1788) | - | 1480412..1481044 (-) | 633 | WP_011018133.1 | N-6 DNA methylase | - |
| SPYM18_RS07695 (spyM18_1789) | - | 1481046..1481330 (-) | 285 | WP_011018134.1 | hypothetical protein | - |
| SPYM18_RS10375 (spyM18_1790) | - | 1481341..1481511 (-) | 171 | WP_011018135.1 | hypothetical protein | - |
| SPYM18_RS07700 (spyM18_1791) | - | 1481508..1481912 (-) | 405 | WP_011018136.1 | YopX family protein | - |
| SPYM18_RS07705 (spyM18_1792) | - | 1481909..1482193 (-) | 285 | WP_011018137.1 | DUF3310 domain-containing protein | - |
| SPYM18_RS10695 | - | 1482187..1482438 (-) | 252 | WP_011106665.1 | hypothetical protein | - |
| SPYM18_RS07715 (spyM18_1793) | - | 1482435..1482791 (-) | 357 | WP_011018138.1 | hypothetical protein | - |
| SPYM18_RS07720 (spyM18_1794) | - | 1482788..1483228 (-) | 441 | WP_011018139.1 | RusA family crossover junction endodeoxyribonuclease | - |
| SPYM18_RS07725 | - | 1483228..1483431 (-) | 204 | WP_032465709.1 | hypothetical protein | - |
| SPYM18_RS07730 (spyM18_1795) | ssbA | 1483437..1483856 (-) | 420 | WP_011018140.1 | single-stranded DNA-binding protein | Machinery gene |
| SPYM18_RS07735 (spyM18_1796) | - | 1483849..1484523 (-) | 675 | WP_011018141.1 | ERF family protein | - |
| SPYM18_RS07740 (spyM18_1797) | - | 1484524..1485006 (-) | 483 | WP_011018142.1 | siphovirus Gp157 family protein | - |
| SPYM18_RS07745 (spyM18_1798) | - | 1485028..1485282 (-) | 255 | WP_011018143.1 | hypothetical protein | - |
| SPYM18_RS07750 (spyM18_1799) | - | 1485263..1485619 (-) | 357 | WP_011018144.1 | HTH domain-containing protein | - |
| SPYM18_RS10380 (spyM18_1800) | - | 1485630..1485767 (-) | 138 | WP_011018145.1 | hypothetical protein | - |
| SPYM18_RS07755 (spyM18_1801) | - | 1485767..1486609 (-) | 843 | WP_011018146.1 | ATP-binding protein | - |
| SPYM18_RS07760 (spyM18_1803) | - | 1486619..1487557 (-) | 939 | WP_011018147.1 | phage replisome organizer N-terminal domain-containing protein | - |
| SPYM18_RS10780 (spyM18_1804) | - | 1487571..1487884 (-) | 314 | Protein_1511 | helix-turn-helix domain-containing protein | - |
| SPYM18_RS07775 | - | 1488066..1488317 (-) | 252 | WP_021340237.1 | helix-turn-helix transcriptional regulator | - |
| SPYM18_RS10385 | - | 1488556..1488723 (-) | 168 | WP_021340232.1 | hypothetical protein | - |
| SPYM18_RS07785 (spyM18_1802) | - | 1488727..1489446 (-) | 720 | WP_011018149.1 | phage antirepressor KilAC domain-containing protein | - |
| SPYM18_RS07790 | - | 1489474..1489686 (-) | 213 | WP_014635614.1 | DNA-binding protein | - |
| SPYM18_RS07795 (spyM18_1805) | - | 1489882..1490223 (+) | 342 | WP_011888679.1 | helix-turn-helix domain-containing protein | - |
| SPYM18_RS07800 | - | 1490207..1490593 (+) | 387 | WP_032463929.1 | ImmA/IrrE family metallo-endopeptidase | - |
| SPYM18_RS07805 (spyM18_1806) | - | 1490608..1492029 (+) | 1422 | WP_011018151.1 | DUF4041 domain-containing protein | - |
| SPYM18_RS07810 (spyM18_1808) | - | 1492207..1493373 (+) | 1167 | WP_011018152.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 139 a.a. Molecular weight: 15663.32 Da Isoelectric Point: 4.8660
>NTDB_id=21952 SPYM18_RS07730 WP_011018140.1 1483437..1483856(-) (ssbA) [Streptococcus pyogenes MGAS8232]
MINNVVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGITGRIQTR
NYENQQGQRVYVTEVVADNFQMLESRNQQSGQGNSSQNDNSQPFGNSNPMDISDDDLPF
MINNVVLVGRMTKDAELRYTASQVAVATFTLAVNRRFKEQNGEREADFINCVIWRQSAENLANWAKKGALIGITGRIQTR
NYENQQGQRVYVTEVVADNFQMLESRNQQSGQGNSSQNDNSQPFGNSNPMDISDDDLPF
Nucleotide
Download Length: 420 bp
>NTDB_id=21952 SPYM18_RS07730 WP_011018140.1 1483437..1483856(-) (ssbA) [Streptococcus pyogenes MGAS8232]
ATGATTAATAACGTAGTACTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCCTTGATCGGAATTACAGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGGACAACGTGTCTATGTAACAGAAGTTGTTGCAGATAATTTCCAAATGTTGGAAAGTCGTAA
TCAACAATCTGGTCAAGGTAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATATTTCAG
ACGATGATCTGCCGTTTTAA
ATGATTAATAACGTAGTACTAGTTGGTCGCATGACCAAGGACGCAGAGCTTCGCTATACAGCGAGTCAAGTAGCTGTAGC
TACGTTCACACTTGCGGTAAACCGCAGATTTAAAGAGCAAAACGGGGAGAGAGAAGCAGATTTCATTAACTGTGTTATCT
GGCGACAGTCTGCTGAAAATTTAGCCAACTGGGCTAAAAAAGGTGCCTTGATCGGAATTACAGGTCGTATTCAGACACGT
AACTACGAAAACCAACAAGGACAACGTGTCTATGTAACAGAAGTTGTTGCAGATAATTTCCAAATGTTGGAAAGTCGTAA
TCAACAATCTGGTCAAGGTAACTCTTCGCAAAACGATAACAGTCAACCGTTTGGCAATTCAAACCCAATGGATATTTCAG
ACGATGATCTGCCGTTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.286 |
100 |
0.683 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.294 |
100 |
0.676 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
45.324 |
100 |
0.453 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
44.604 |
100 |
0.446 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
44.604 |
100 |
0.446 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
44.604 |
100 |
0.446 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
44.604 |
100 |
0.446 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
44.604 |
100 |
0.446 |
| ssbB/cilA | Streptococcus mitis SK321 |
44.604 |
100 |
0.446 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
54.054 |
79.856 |
0.432 |
| ssbA | Streptococcus mutans UA159 |
41.727 |
100 |
0.417 |
| ssb | Vibrio cholerae strain A1552 |
31.792 |
100 |
0.396 |