Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | BXP28_RS03180 | Genome accession | NZ_CP019687 |
| Coordinates | 575729..576133 (+) | Length | 134 a.a. |
| NCBI ID | WP_036658655.1 | Uniprot ID | - |
| Organism | Paenibacillus larvae subsp. larvae strain ATCC-9545 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 567632..608887 | 575729..576133 | within | 0 |
Gene organization within MGE regions
Location: 567632..608887
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BXP28_RS03100 (BXP28_03120) | - | 567632..569314 (-) | 1683 | WP_023484366.1 | recombinase family protein | - |
| BXP28_RS03105 (BXP28_03125) | - | 569316..569654 (-) | 339 | WP_036658676.1 | helix-turn-helix domain-containing protein | - |
| BXP28_RS03110 (BXP28_03130) | - | 569791..569970 (+) | 180 | WP_235430683.1 | helix-turn-helix transcriptional regulator | - |
| BXP28_RS03115 (BXP28_03135) | - | 570093..570284 (+) | 192 | WP_144029586.1 | hypothetical protein | - |
| BXP28_RS03120 (BXP28_03140) | - | 570299..570568 (+) | 270 | WP_036658672.1 | hypothetical protein | - |
| BXP28_RS03125 (BXP28_03145) | - | 570589..570792 (+) | 204 | WP_036658670.1 | hypothetical protein | - |
| BXP28_RS03130 (BXP28_03150) | - | 570799..571176 (+) | 378 | WP_036658668.1 | hypothetical protein | - |
| BXP28_RS03135 (BXP28_03155) | - | 571173..571403 (+) | 231 | WP_036658666.1 | hypothetical protein | - |
| BXP28_RS22425 | - | 571387..571560 (+) | 174 | WP_155116304.1 | hypothetical protein | - |
| BXP28_RS03140 (BXP28_03160) | - | 571565..572317 (+) | 753 | WP_023483806.1 | phage antirepressor KilAC domain-containing protein | - |
| BXP28_RS03145 (BXP28_03165) | - | 572314..572889 (+) | 576 | WP_036658665.1 | hypothetical protein | - |
| BXP28_RS03150 (BXP28_03170) | - | 572882..573139 (+) | 258 | WP_036658663.1 | hypothetical protein | - |
| BXP28_RS03155 (BXP28_03175) | - | 573129..573641 (-) | 513 | WP_036658661.1 | hypothetical protein | - |
| BXP28_RS03160 (BXP28_03180) | - | 573728..574072 (+) | 345 | WP_036658659.1 | hypothetical protein | - |
| BXP28_RS22430 | - | 574050..574190 (+) | 141 | WP_155116354.1 | hypothetical protein | - |
| BXP28_RS03165 (BXP28_03185) | - | 574290..574553 (+) | 264 | WP_036658656.1 | hypothetical protein | - |
| BXP28_RS03170 (BXP28_03190) | - | 574550..575098 (+) | 549 | WP_023485214.1 | host-nuclease inhibitor Gam family protein | - |
| BXP28_RS03175 (BXP28_03195) | - | 575101..575739 (+) | 639 | WP_023485215.1 | ERF family protein | - |
| BXP28_RS03180 (BXP28_03200) | ssbA | 575729..576133 (+) | 405 | WP_036658655.1 | single-stranded DNA-binding protein | Machinery gene |
| BXP28_RS03185 (BXP28_03205) | - | 576142..576531 (+) | 390 | WP_036658652.1 | hypothetical protein | - |
| BXP28_RS03190 (BXP28_03210) | - | 576528..576860 (+) | 333 | WP_036658651.1 | hypothetical protein | - |
| BXP28_RS03195 (BXP28_03215) | - | 576940..577722 (+) | 783 | WP_023483153.1 | DnaD domain-containing protein | - |
| BXP28_RS03200 (BXP28_03220) | - | 577613..578434 (+) | 822 | WP_077584884.1 | ATP-binding protein | - |
| BXP28_RS03205 (BXP28_03225) | - | 578553..578771 (+) | 219 | WP_036658649.1 | hypothetical protein | - |
| BXP28_RS03210 (BXP28_03230) | - | 578764..579138 (+) | 375 | WP_036658646.1 | RusA family crossover junction endodeoxyribonuclease | - |
| BXP28_RS03215 (BXP28_03235) | - | 579320..579685 (+) | 366 | WP_036658643.1 | hypothetical protein | - |
| BXP28_RS03220 (BXP28_03240) | - | 579702..580484 (+) | 783 | WP_023483250.1 | DNA cytosine methyltransferase | - |
| BXP28_RS03225 (BXP28_03245) | - | 580468..580650 (+) | 183 | WP_036658642.1 | hypothetical protein | - |
| BXP28_RS03230 (BXP28_03250) | - | 580702..580935 (+) | 234 | WP_036658640.1 | hypothetical protein | - |
| BXP28_RS03235 (BXP28_03255) | - | 580928..581173 (+) | 246 | WP_036658638.1 | hypothetical protein | - |
| BXP28_RS22435 | - | 581170..581313 (+) | 144 | WP_155116353.1 | hypothetical protein | - |
| BXP28_RS03240 (BXP28_03260) | - | 581442..581879 (+) | 438 | WP_077584885.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| BXP28_RS03245 (BXP28_03265) | - | 582085..582429 (+) | 345 | WP_036658635.1 | YxeA family protein | - |
| BXP28_RS03250 (BXP28_03270) | - | 582484..582900 (-) | 417 | WP_023484796.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| BXP28_RS03255 (BXP28_03275) | - | 582931..583134 (-) | 204 | WP_036658634.1 | type II toxin-antitoxin system HicA family toxin | - |
| BXP28_RS03260 (BXP28_03280) | - | 583314..583628 (+) | 315 | WP_023484126.1 | hypothetical protein | - |
| BXP28_RS23800 | - | 583789..583959 (+) | 171 | WP_235430734.1 | HNH endonuclease | - |
| BXP28_RS03270 (BXP28_03290) | - | 584063..584377 (+) | 315 | WP_023484127.1 | P27 family phage terminase small subunit | - |
| BXP28_RS03275 (BXP28_03295) | - | 584355..586082 (+) | 1728 | WP_036656295.1 | terminase large subunit | - |
| BXP28_RS03280 (BXP28_03300) | - | 586097..587332 (+) | 1236 | WP_036656297.1 | phage portal protein | - |
| BXP28_RS03285 (BXP28_03305) | - | 587283..588038 (+) | 756 | WP_036656299.1 | head maturation protease, ClpP-related | - |
| BXP28_RS03290 (BXP28_03310) | - | 588035..589177 (+) | 1143 | WP_023484582.1 | phage major capsid protein | - |
| BXP28_RS03295 (BXP28_03315) | - | 589303..589566 (+) | 264 | WP_036656301.1 | head-tail connector protein | - |
| BXP28_RS03300 (BXP28_03320) | - | 589563..589883 (+) | 321 | WP_023484581.1 | phage head closure protein | - |
| BXP28_RS03305 (BXP28_03325) | - | 589880..590272 (+) | 393 | WP_036656302.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| BXP28_RS03310 (BXP28_03330) | - | 590269..590598 (+) | 330 | WP_036656304.1 | hypothetical protein | - |
| BXP28_RS03315 (BXP28_03335) | - | 590634..591230 (+) | 597 | WP_046655268.1 | major tail protein | - |
| BXP28_RS03320 (BXP28_03340) | - | 591302..591673 (+) | 372 | WP_023484578.1 | hypothetical protein | - |
| BXP28_RS03325 (BXP28_03345) | - | 591907..592338 (+) | 432 | WP_077584888.1 | hypothetical protein | - |
| BXP28_RS03330 (BXP28_03350) | - | 592284..595610 (+) | 3327 | WP_077584889.1 | phage tail tape measure protein | - |
| BXP28_RS03335 (BXP28_03355) | - | 595611..596477 (+) | 867 | WP_023484576.1 | phage tail family protein | - |
| BXP28_RS03340 (BXP28_03360) | - | 596480..597598 (+) | 1119 | WP_023484575.1 | siphovirus ReqiPepy6 Gp37-like family protein | - |
| BXP28_RS03345 (BXP28_03365) | - | 597604..598677 (+) | 1074 | WP_051428011.1 | hypothetical protein | - |
| BXP28_RS03350 (BXP28_03370) | - | 598687..599028 (+) | 342 | WP_036656307.1 | hypothetical protein | - |
| BXP28_RS23160 | - | 599025..599186 (+) | 162 | WP_167552488.1 | hypothetical protein | - |
| BXP28_RS03355 (BXP28_03375) | - | 599167..599406 (+) | 240 | WP_024094415.1 | BhlA/UviB family holin-like peptide | - |
| BXP28_RS03360 (BXP28_03380) | - | 599406..599885 (+) | 480 | Protein_675 | N-acetylmuramoyl-L-alanine amidase family protein | - |
| BXP28_RS03370 (BXP28_03390) | - | 600365..600619 (+) | 255 | WP_051428122.1 | hypothetical protein | - |
| BXP28_RS03375 (BXP28_03395) | - | 600806..601774 (+) | 969 | WP_077584890.1 | hypothetical protein | - |
| BXP28_RS03380 (BXP28_03400) | - | 601794..602147 (+) | 354 | WP_036658891.1 | hypothetical protein | - |
| BXP28_RS03385 (BXP28_03405) | - | 602131..602574 (+) | 444 | WP_036658895.1 | hypothetical protein | - |
| BXP28_RS03390 (BXP28_03410) | - | 603427..606354 (+) | 2928 | WP_023484754.1 | RICIN domain-containing protein | - |
| BXP28_RS03395 (BXP28_03415) | - | 606666..606929 (-) | 264 | WP_036653966.1 | hypothetical protein | - |
| BXP28_RS03400 (BXP28_03420) | - | 607015..607200 (-) | 186 | WP_036653970.1 | hypothetical protein | - |
| BXP28_RS03405 (BXP28_03425) | - | 607669..607896 (+) | 228 | WP_036653973.1 | helix-turn-helix transcriptional regulator | - |
| BXP28_RS23805 | - | 608096..608155 (+) | 60 | WP_230460812.1 | putative holin-like toxin | - |
Sequence
Protein
Download Length: 134 a.a. Molecular weight: 15606.49 Da Isoelectric Point: 5.9505
>NTDB_id=217839 BXP28_RS03180 WP_036658655.1 575729..576133(+) (ssbA) [Paenibacillus larvae subsp. larvae strain ATCC-9545]
MLNRVVLIGRLTRDPELRYTPSGVAVTKFTLAVDRPYMNQQTRERETDFINIVTWRQTAEACANHLRKGRLTAVEGRIQV
RNYENNEGRRIYVTEVVADNVRFLESSKNENKRPEDPFYDSSTPLDISDDELPF
MLNRVVLIGRLTRDPELRYTPSGVAVTKFTLAVDRPYMNQQTRERETDFINIVTWRQTAEACANHLRKGRLTAVEGRIQV
RNYENNEGRRIYVTEVVADNVRFLESSKNENKRPEDPFYDSSTPLDISDDELPF
Nucleotide
Download Length: 405 bp
>NTDB_id=217839 BXP28_RS03180 WP_036658655.1 575729..576133(+) (ssbA) [Paenibacillus larvae subsp. larvae strain ATCC-9545]
ATGCTGAATAGGGTTGTTTTAATCGGCAGACTGACGAGAGATCCGGAATTAAGATATACTCCATCCGGTGTAGCTGTCAC
CAAGTTTACCCTGGCGGTAGACCGTCCGTATATGAACCAGCAAACGCGTGAGCGAGAGACGGATTTCATTAATATCGTGA
CGTGGAGACAAACCGCGGAAGCCTGTGCCAATCACCTTCGCAAAGGCCGTTTGACGGCAGTAGAAGGAAGAATCCAGGTG
CGTAATTATGAGAACAATGAGGGCCGCAGAATCTATGTAACCGAGGTTGTGGCTGATAATGTGCGCTTTCTTGAATCAAG
TAAAAATGAAAATAAACGCCCTGAAGACCCTTTCTACGACTCTAGCACACCACTAGACATTTCAGATGATGAACTCCCCT
TCTAG
ATGCTGAATAGGGTTGTTTTAATCGGCAGACTGACGAGAGATCCGGAATTAAGATATACTCCATCCGGTGTAGCTGTCAC
CAAGTTTACCCTGGCGGTAGACCGTCCGTATATGAACCAGCAAACGCGTGAGCGAGAGACGGATTTCATTAATATCGTGA
CGTGGAGACAAACCGCGGAAGCCTGTGCCAATCACCTTCGCAAAGGCCGTTTGACGGCAGTAGAAGGAAGAATCCAGGTG
CGTAATTATGAGAACAATGAGGGCCGCAGAATCTATGTAACCGAGGTTGTGGCTGATAATGTGCGCTTTCTTGAATCAAG
TAAAAATGAAAATAAACGCCCTGAAGACCCTTTCTACGACTCTAGCACACCACTAGACATTTCAGATGATGAACTCCCCT
TCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
47.977 |
100 |
0.619 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
45.029 |
100 |
0.575 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
54.286 |
78.358 |
0.425 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
41.791 |
100 |
0.418 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
41.045 |
100 |
0.41 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
40.299 |
100 |
0.403 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40.299 |
100 |
0.403 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
40.299 |
100 |
0.403 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
40.299 |
100 |
0.403 |
| ssbB/cilA | Streptococcus mitis SK321 |
40.299 |
100 |
0.403 |
| ssb | Neisseria gonorrhoeae MS11 |
41.6 |
93.284 |
0.388 |
| ssbA | Streptococcus mutans UA159 |
38.06 |
100 |
0.381 |