Detailed information
Overview
| Name | comGC | Type | Machinery gene |
| Locus tag | CWI26_RS00820 | Genome accession | NZ_CP025043 |
| Coordinates | 135408..135689 (+) | Length | 93 a.a. |
| NCBI ID | WP_044760307.1 | Uniprot ID | - |
| Organism | Streptococcus suis strain AH681 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 130408..140689
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CWI26_RS00795 (CWI26_00795) | - | 130432..131688 (-) | 1257 | WP_100881034.1 | ISL3 family transposase | - |
| CWI26_RS00800 (CWI26_00800) | - | 131967..132326 (+) | 360 | WP_044776736.1 | DUF1033 family protein | - |
| CWI26_RS00805 (CWI26_00805) | - | 132471..133421 (-) | 951 | WP_100881035.1 | S66 family peptidase | - |
| CWI26_RS00810 (CWI26_00810) | comGA | 133507..134457 (+) | 951 | WP_044760311.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| CWI26_RS00815 (CWI26_00815) | comGB | 134369..135406 (+) | 1038 | WP_233486262.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| CWI26_RS00820 (CWI26_00820) | comGC | 135408..135689 (+) | 282 | WP_044760307.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| CWI26_RS00825 (CWI26_00825) | comGD | 135670..136077 (+) | 408 | WP_100881037.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| CWI26_RS00830 (CWI26_00830) | comGE | 136049..136342 (+) | 294 | WP_100881038.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| CWI26_RS00835 (CWI26_00835) | comGF/cglF | 136329..136763 (+) | 435 | WP_100881039.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| CWI26_RS00840 (CWI26_00840) | comGG | 136741..137268 (+) | 528 | WP_029180264.1 | competence type IV pilus minor pilin ComGG | - |
| CWI26_RS00845 (CWI26_00845) | comGH | 137325..138278 (+) | 954 | WP_100881040.1 | class I SAM-dependent methyltransferase | Machinery gene |
| CWI26_RS00850 (CWI26_00850) | - | 138328..139515 (+) | 1188 | WP_100881041.1 | acetate kinase | - |
| CWI26_RS00860 (CWI26_00860) | - | 139829..140380 (+) | 552 | WP_100881043.1 | folate family ECF transporter S component | - |
Sequence
Protein
Download Length: 93 a.a. Molecular weight: 10463.42 Da Isoelectric Point: 7.0117
>NTDB_id=216576 CWI26_RS00820 WP_044760307.1 135408..135689(+) (comGC) [Streptococcus suis strain AH681]
MKKLIEMKVKAFTLVEMLVVLGIISLLLLIFVPNLSQQKDAIQKKGNAAVIKVVESQMELYELEHDKEATVADLQADGYI
TEKQAEQYAKAKK
MKKLIEMKVKAFTLVEMLVVLGIISLLLLIFVPNLSQQKDAIQKKGNAAVIKVVESQMELYELEHDKEATVADLQADGYI
TEKQAEQYAKAKK
Nucleotide
Download Length: 282 bp
>NTDB_id=216576 CWI26_RS00820 WP_044760307.1 135408..135689(+) (comGC) [Streptococcus suis strain AH681]
ATGAAAAAATTAATTGAAATGAAGGTAAAAGCGTTCACTCTGGTGGAAATGTTAGTTGTTTTGGGTATTATTAGCCTGCT
CTTGCTCATTTTTGTGCCAAATTTGAGCCAGCAGAAGGATGCTATTCAGAAGAAGGGGAATGCGGCTGTTATCAAAGTGG
TGGAGAGTCAAATGGAACTCTATGAATTGGAACATGACAAGGAAGCAACGGTGGCAGACTTGCAAGCGGATGGCTATATT
ACTGAAAAACAAGCGGAGCAGTATGCTAAGGCGAAAAAATAA
ATGAAAAAATTAATTGAAATGAAGGTAAAAGCGTTCACTCTGGTGGAAATGTTAGTTGTTTTGGGTATTATTAGCCTGCT
CTTGCTCATTTTTGTGCCAAATTTGAGCCAGCAGAAGGATGCTATTCAGAAGAAGGGGAATGCGGCTGTTATCAAAGTGG
TGGAGAGTCAAATGGAACTCTATGAATTGGAACATGACAAGGAAGCAACGGTGGCAGACTTGCAAGCGGATGGCTATATT
ACTGAAAAACAAGCGGAGCAGTATGCTAAGGCGAAAAAATAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC | Streptococcus suis isolate S10 |
90.323 |
100 |
0.903 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.043 |
98.925 |
0.624 |
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.043 |
98.925 |
0.624 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.043 |
98.925 |
0.624 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.043 |
98.925 |
0.624 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
63.043 |
98.925 |
0.624 |
| comGC/cglC | Streptococcus mitis SK321 |
63.043 |
98.925 |
0.624 |
| comGC | Streptococcus gordonii str. Challis substr. CH1 |
61.798 |
95.699 |
0.591 |
| comGC | Streptococcus mutans UA140 |
59.091 |
94.624 |
0.559 |
| comGC | Streptococcus mutans UA159 |
59.091 |
94.624 |
0.559 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
55.682 |
94.624 |
0.527 |
| comGC | Staphylococcus aureus MW2 |
50 |
83.871 |
0.419 |
| comGC | Staphylococcus aureus N315 |
50 |
83.871 |
0.419 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
49.333 |
80.645 |
0.398 |