Detailed information NTG0183195

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: LLUC11_RS10825
• Genome accession: NZ_CP015904
• Coordinates: 2193509..2193892 (-)
• Length: 127 a.a.
• NCBI ID: WP_081040674.1
• Uniprot ID: A0A0V8E8R1
• Organism: Lactococcus lactis subsp. lactis strain UC11
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 2188509..2198892

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LLUC11_RS10785 (LLUC11_2083)	-	2189043..2189852 (-)	810	WP_014570791.1	metal ABC transporter permease	-
LLUC11_RS10790 (LLUC11_2084)	-	2189845..2190582 (-)	738	WP_012898617.1	metal ABC transporter ATP-binding protein	-
LLUC11_RS10795 (LLUC11_2085)	-	2190759..2191601 (-)	843	WP_015427160.1	metal ABC transporter substrate-binding protein	-
LLUC11_RS10800 (LLUC11_2086)	-	2191598..2192035 (-)	438	WP_003129992.1	zinc-dependent MarR family transcriptional regulator	-
LLUC11_RS10805 (LLUC11_2087)	comGG	2192117..2192401 (-)	285	WP_025017139.1	competence type IV pilus minor pilin ComGG	Machinery gene
LLUC11_RS10810 (LLUC11_2088)	comGF	2192440..2192886 (-)	447	WP_029344525.1	competence type IV pilus minor pilin ComGF	Machinery gene
LLUC11_RS10815 (LLUC11_2089)	comGE	2192849..2193145 (-)	297	WP_010906316.1	competence type IV pilus minor pilin ComGE	Machinery gene
LLUC11_RS10820 (LLUC11_2090)	comGD	2193235..2193534 (-)	300	WP_289667678.1	prepilin-type N-terminal cleavage/methylation domain-containing protein	Machinery gene
LLUC11_RS10825 (LLUC11_2091)	comGC	2193509..2193892 (-)	384	WP_081040674.1	competence type IV pilus major pilin ComGC	Machinery gene
LLUC11_RS10830 (LLUC11_2092)	comGB	2193906..2194979 (-)	1074	WP_081041295.1	competence type IV pilus assembly protein ComGB	Machinery gene
LLUC11_RS10835 (LLUC11_2093)	comGA	2194873..2195811 (-)	939	WP_031561106.1	competence type IV pilus ATPase ComGA	Machinery gene

Sequence

Protein

• Length: 127 a.a.
• Molecular weight: 14824.42 Da
• Isoelectric Point: 8.4538

>NTDB_id=183195 LLUC11_RS10825 WP_081040674.1 2193509..2193892(-) (comGC) [Lactococcus lactis subsp. lactis strain UC11]
MERTKKFILKKIQKIFLFVKICEKKCRQKELKAFTLIEMLIVLAIISILILLFVPNLIKEKSQVQKTGEAAVVKVVESQA
QLYELDHDDEKPSLSELLNAGMITQKQISAYDNYYDQNKNEERNFND

Nucleotide

• Length: 384 bp

>NTDB_id=183195 LLUC11_RS10825 WP_081040674.1 2193509..2193892(-) (comGC) [Lactococcus lactis subsp. lactis strain UC11]
ATGGAAAGAACAAAGAAGTTTATTTTAAAAAAAATACAAAAGATATTTTTATTCGTTAAAATTTGTGAAAAAAAATGCCG
TCAGAAAGAGCTAAAAGCTTTTACTTTGATAGAGATGTTAATTGTACTAGCTATTATTAGTATTTTGATATTACTATTTG
TTCCAAATTTAATTAAAGAAAAATCACAAGTTCAAAAAACTGGAGAAGCGGCAGTTGTAAAAGTAGTAGAAAGTCAAGCT
CAACTTTATGAATTAGATCATGATGATGAGAAGCCGAGTCTGTCAGAATTGCTCAACGCTGGGATGATTACTCAAAAACA
AATTTCTGCTTACGATAATTACTATGATCAGAACAAAAATGAAGAACGAAATTTTAATGACTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (32-52)

3D structure

• AlphaFold DB: A0A0V8E8R1

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Lactococcus lactis subsp. cremoris KW2	80.172	91.339	0.732
comGC/cglC	Streptococcus mitis SK321	56.436	79.528	0.449
comYC	Streptococcus mutans UA159	55.446	79.528	0.441
comYC	Streptococcus mutans UA140	55.446	79.528	0.441
comYC	Streptococcus gordonii str. Challis substr. CH1	56.566	77.953	0.441
comGC/cglC	Streptococcus pneumoniae TIGR4	54.455	79.528	0.433
comGC/cglC	Streptococcus pneumoniae Rx1	54.455	79.528	0.433
comGC/cglC	Streptococcus pneumoniae D39	54.455	79.528	0.433
comGC/cglC	Streptococcus pneumoniae R6	54.455	79.528	0.433
comGC/cglC	Streptococcus mitis NCTC 12261	58.427	70.079	0.409
comYC	Streptococcus suis isolate S10	56.818	69.291	0.394