Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGD   Type   Machinery gene
Locus tag   LLUC11_RS10820 Genome accession   NZ_CP015904
Coordinates   2193235..2193534 (-) Length   99 a.a.
NCBI ID   WP_289667678.1    Uniprot ID   -
Organism   Lactococcus lactis subsp. lactis strain UC11     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2188235..2198534
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LLUC11_RS10785 (LLUC11_2083) - 2189043..2189852 (-) 810 WP_014570791.1 metal ABC transporter permease -
  LLUC11_RS10790 (LLUC11_2084) - 2189845..2190582 (-) 738 WP_012898617.1 metal ABC transporter ATP-binding protein -
  LLUC11_RS10795 (LLUC11_2085) - 2190759..2191601 (-) 843 WP_015427160.1 metal ABC transporter substrate-binding protein -
  LLUC11_RS10800 (LLUC11_2086) - 2191598..2192035 (-) 438 WP_003129992.1 zinc-dependent MarR family transcriptional regulator -
  LLUC11_RS10805 (LLUC11_2087) comGG 2192117..2192401 (-) 285 WP_025017139.1 competence type IV pilus minor pilin ComGG Machinery gene
  LLUC11_RS10810 (LLUC11_2088) comGF 2192440..2192886 (-) 447 WP_029344525.1 competence type IV pilus minor pilin ComGF Machinery gene
  LLUC11_RS10815 (LLUC11_2089) comGE 2192849..2193145 (-) 297 WP_010906316.1 competence type IV pilus minor pilin ComGE Machinery gene
  LLUC11_RS10820 (LLUC11_2090) comGD 2193235..2193534 (-) 300 WP_289667678.1 prepilin-type N-terminal cleavage/methylation domain-containing protein Machinery gene
  LLUC11_RS10825 (LLUC11_2091) comGC 2193509..2193892 (-) 384 WP_081040674.1 competence type IV pilus major pilin ComGC Machinery gene
  LLUC11_RS10830 (LLUC11_2092) comGB 2193906..2194979 (-) 1074 WP_081041295.1 competence type IV pilus assembly protein ComGB Machinery gene
  LLUC11_RS10835 (LLUC11_2093) comGA 2194873..2195811 (-) 939 WP_031561106.1 competence type IV pilus ATPase ComGA Machinery gene

Sequence

Protein


Download         Length: 99 a.a.        Molecular weight: 11425.47 Da        Isoelectric Point: 5.1440

>NTDB_id=183194 LLUC11_RS10820 WP_289667678.1 2193235..2193534(-) (comGD) [Lactococcus lactis subsp. lactis strain UC11]
MKNEILMTRAFTLLESLLVLLIISFITTLFSSEIIQTVHLFKGELFVLQFENFYKRSQEEAALLQKSESLVAKNQELICE
DRSITIPKEVAVKDFTVKL

Nucleotide


Download         Length: 300 bp        

>NTDB_id=183194 LLUC11_RS10820 WP_289667678.1 2193235..2193534(-) (comGD) [Lactococcus lactis subsp. lactis strain UC11]
ATGAAGAACGAAATTTTAATGACTAGAGCATTTACTTTACTAGAGTCTCTTCTAGTTTTGTTGATTATTTCTTTTATCAC
AACTCTTTTTTCTTCAGAAATAATACAAACAGTCCATCTTTTTAAGGGAGAATTGTTTGTTCTTCAATTTGAAAATTTCT
ATAAAAGGAGTCAAGAAGAGGCTGCACTGCTTCAAAAATCTGAAAGTTTAGTTGCTAAAAATCAAGAATTAATCTGTGAA
GATAGAAGTATCACAATTCCAAAGGAGGTAGCAGTTAAAGATTTTACAGTTAAATTATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Lactococcus lactis subsp. cremoris KW2

65.306

98.99

0.646

Multiple sequence alignment