Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | LLJM3_RS10370 | Genome accession | NZ_CP015901 |
| Coordinates | 2020847..2021272 (-) | Length | 141 a.a. |
| NCBI ID | WP_011676939.1 | Uniprot ID | A0AA34TL31 |
| Organism | Lactococcus cremoris strain JM3 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1985619..2031174 | 2020847..2021272 | within | 0 |
Gene organization within MGE regions
Location: 1985619..2031174
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLJM3_RS10140 (LLJM3_1995) | - | 1987464..1988240 (-) | 777 | WP_011676898.1 | Stp1/IreP family PP2C-type Ser/Thr phosphatase | - |
| LLJM3_RS10145 (LLJM3_1996) | rsmB | 1988363..1989637 (-) | 1275 | WP_011676899.1 | 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB | - |
| LLJM3_RS10150 (LLJM3_1997) | - | 1989925..1990551 (-) | 627 | WP_011676900.1 | hypothetical protein | - |
| LLJM3_RS10155 (LLJM3_1998) | - | 1990662..1991600 (-) | 939 | WP_041167469.1 | glycosyltransferase family 2 protein | - |
| LLJM3_RS10160 (LLJM3_1999) | - | 1991518..1993119 (-) | 1602 | WP_011676902.1 | glycosyltransferase family 39 protein | - |
| LLJM3_RS10165 (LLJM3_2000) | - | 1993259..1994038 (-) | 780 | WP_063284079.1 | peptidoglycan amidohydrolase family protein | - |
| LLJM3_RS10170 (LLJM3_2001) | - | 1994025..1994327 (-) | 303 | WP_063284078.1 | phage holin | - |
| LLJM3_RS10175 (LLJM3_2002) | - | 1994340..1994711 (-) | 372 | WP_011676904.1 | hypothetical protein | - |
| LLJM3_RS13915 | - | 1994729..1995073 (-) | 345 | WP_371857207.1 | hypothetical protein | - |
| LLJM3_RS13920 | - | 1995266..1995847 (-) | 582 | Protein_1985 | hypothetical protein | - |
| LLJM3_RS10185 (LLJM3_2004) | - | 1996186..1996323 (-) | 138 | WP_011676905.1 | hypothetical protein | - |
| LLJM3_RS10190 (LLJM3_2005) | - | 1996320..1998821 (-) | 2502 | WP_041167470.1 | gp58-like family protein | - |
| LLJM3_RS10195 (LLJM3_2006) | - | 1998833..1999198 (-) | 366 | WP_011676906.1 | DUF6711 family protein | - |
| LLJM3_RS10200 (LLJM3_2007) | - | 1999210..2003910 (-) | 4701 | WP_011676907.1 | tail protein | - |
| LLJM3_RS10205 (LLJM3_2008) | - | 2003942..2004313 (-) | 372 | WP_011676908.1 | hypothetical protein | - |
| LLJM3_RS10210 (LLJM3_2009) | - | 2004337..2004747 (-) | 411 | WP_011676909.1 | DUF6096 family protein | - |
| LLJM3_RS10215 (LLJM3_2010) | - | 2004821..2005234 (-) | 414 | WP_011676910.1 | phage tail tube protein | - |
| LLJM3_RS10220 (LLJM3_2011) | - | 2005247..2005609 (-) | 363 | WP_011676911.1 | hypothetical protein | - |
| LLJM3_RS10225 (LLJM3_2012) | - | 2005609..2006157 (-) | 549 | WP_011676912.1 | hypothetical protein | - |
| LLJM3_RS10230 (LLJM3_2013) | - | 2006141..2006494 (-) | 354 | WP_041167471.1 | hypothetical protein | - |
| LLJM3_RS10235 (LLJM3_2014) | - | 2006475..2006801 (-) | 327 | WP_011676914.1 | phage head-tail connector protein | - |
| LLJM3_RS10240 (LLJM3_2015) | - | 2006822..2007940 (-) | 1119 | WP_011676915.1 | Ig-like domain-containing protein | - |
| LLJM3_RS10245 (LLJM3_2016) | - | 2007952..2008608 (-) | 657 | WP_041167616.1 | DUF4355 domain-containing protein | - |
| LLJM3_RS10250 (LLJM3_2017) | - | 2008773..2009879 (-) | 1107 | WP_011676917.1 | minor capsid protein | - |
| LLJM3_RS10255 (LLJM3_2018) | - | 2009885..2010172 (-) | 288 | WP_011676918.1 | ribosomal-processing cysteine protease Prp | - |
| LLJM3_RS10260 (LLJM3_2019) | - | 2010169..2010399 (-) | 231 | WP_041167618.1 | hypothetical protein | - |
| LLJM3_RS10265 (LLJM3_2020) | - | 2010441..2010605 (-) | 165 | WP_011676920.1 | hypothetical protein | - |
| LLJM3_RS10270 (LLJM3_2021) | - | 2010562..2012070 (-) | 1509 | WP_011676921.1 | phage portal protein | - |
| LLJM3_RS10275 (LLJM3_2022) | - | 2012079..2013314 (-) | 1236 | WP_011676922.1 | PBSX family phage terminase large subunit | - |
| LLJM3_RS10280 (LLJM3_2023) | - | 2013304..2013816 (-) | 513 | WP_011676923.1 | terminase small subunit | - |
| LLJM3_RS10285 (LLJM3_2024) | - | 2014112..2014537 (-) | 426 | WP_003131928.1 | RinA family protein | - |
| LLJM3_RS10290 (LLJM3_2025) | - | 2014614..2014922 (-) | 309 | WP_011676924.1 | hypothetical protein | - |
| LLJM3_RS10295 (LLJM3_2026) | - | 2015255..2015467 (-) | 213 | WP_237024555.1 | hypothetical protein | - |
| LLJM3_RS10300 (LLJM3_2027) | - | 2015448..2015642 (-) | 195 | WP_011676926.1 | DUF1660 domain-containing protein | - |
| LLJM3_RS10305 (LLJM3_2028) | - | 2015639..2015881 (-) | 243 | WP_011676927.1 | hypothetical protein | - |
| LLJM3_RS10310 (LLJM3_2029) | - | 2015932..2016618 (-) | 687 | WP_011676928.1 | hypothetical protein | - |
| LLJM3_RS10315 (LLJM3_2030) | - | 2016605..2016916 (-) | 312 | WP_011676929.1 | hypothetical protein | - |
| LLJM3_RS10320 (LLJM3_2031) | dut | 2016916..2017335 (-) | 420 | WP_011676930.1 | dUTP diphosphatase | - |
| LLJM3_RS10325 (LLJM3_2032) | - | 2017332..2017688 (-) | 357 | WP_011676931.1 | hypothetical protein | - |
| LLJM3_RS10330 (LLJM3_2033) | - | 2017685..2018206 (-) | 522 | WP_011676932.1 | DUF1642 domain-containing protein | - |
| LLJM3_RS10335 (LLJM3_2034) | - | 2018199..2018405 (-) | 207 | WP_011676933.1 | DUF1125 domain-containing protein | - |
| LLJM3_RS10340 (LLJM3_2035) | - | 2018419..2018943 (-) | 525 | WP_011676934.1 | hypothetical protein | - |
| LLJM3_RS10345 (LLJM3_2036) | - | 2019050..2019289 (-) | 240 | WP_011676935.1 | DUF1031 domain-containing protein | - |
| LLJM3_RS10350 (LLJM3_2037) | - | 2019290..2019421 (-) | 132 | WP_257590451.1 | hypothetical protein | - |
| LLJM3_RS10355 (LLJM3_2038) | - | 2019456..2019710 (-) | 255 | WP_011676936.1 | hypothetical protein | - |
| LLJM3_RS10360 (LLJM3_2039) | - | 2019700..2019921 (-) | 222 | WP_011676937.1 | hypothetical protein | - |
| LLJM3_RS13835 (LLJM3_04720) | - | 2019902..2020704 (-) | 803 | Protein_2022 | DnaD domain protein | - |
| LLJM3_RS10370 (LLJM3_2041) | ssb | 2020847..2021272 (-) | 426 | WP_011676939.1 | single-stranded DNA-binding protein | Machinery gene |
| LLJM3_RS10375 (LLJM3_2042) | - | 2021265..2022023 (-) | 759 | WP_011676940.1 | Rad52/Rad22 family DNA repair protein | - |
| LLJM3_RS10380 (LLJM3_2043) | - | 2022032..2022427 (-) | 396 | WP_011676941.1 | hypothetical protein | - |
| LLJM3_RS10385 (LLJM3_2044) | - | 2022526..2022762 (-) | 237 | WP_011676942.1 | DUF1408 domain-containing protein | - |
| LLJM3_RS10390 (LLJM3_2045) | - | 2022868..2023224 (+) | 357 | WP_011676943.1 | DUF2513 domain-containing protein | - |
| LLJM3_RS10395 (LLJM3_2046) | - | 2023212..2023646 (-) | 435 | WP_011676944.1 | hypothetical protein | - |
| LLJM3_RS10400 (LLJM3_2047) | - | 2023740..2024009 (-) | 270 | WP_011676945.1 | hypothetical protein | - |
| LLJM3_RS10405 (LLJM3_2048) | - | 2024022..2024804 (-) | 783 | WP_011676946.1 | phage repressor protein/antirepressor Ant | - |
| LLJM3_RS10410 (LLJM3_2049) | - | 2024817..2025056 (-) | 240 | WP_011676947.1 | helix-turn-helix transcriptional regulator | - |
| LLJM3_RS10415 (LLJM3_2050) | - | 2025154..2025663 (+) | 510 | WP_011676948.1 | hypothetical protein | - |
| LLJM3_RS10420 (LLJM3_2052) | - | 2026281..2026475 (-) | 195 | WP_011676952.1 | putative transcriptional regulator | - |
| LLJM3_RS10425 (LLJM3_2053) | - | 2026738..2027265 (+) | 528 | WP_011676953.1 | helix-turn-helix domain-containing protein | - |
| LLJM3_RS10430 (LLJM3_2054) | - | 2027271..2027705 (+) | 435 | WP_011676954.1 | zinc peptidase | - |
| LLJM3_RS10435 (LLJM3_2055) | - | 2027719..2028054 (+) | 336 | WP_011676955.1 | hypothetical protein | - |
| LLJM3_RS10440 (LLJM3_2056) | - | 2028121..2029302 (+) | 1182 | WP_011676956.1 | site-specific integrase | - |
| LLJM3_RS10445 (LLJM3_2057) | - | 2029597..2030103 (-) | 507 | WP_011676957.1 | Asp23/Gls24 family envelope stress response protein | - |
| LLJM3_RS10450 (LLJM3_2058) | - | 2030113..2030301 (-) | 189 | WP_011676958.1 | DUF2273 domain-containing protein | - |
| LLJM3_RS10455 (LLJM3_2059) | amaP | 2030312..2030872 (-) | 561 | WP_011676959.1 | alkaline shock response membrane anchor protein AmaP | - |
| LLJM3_RS10460 (LLJM3_2060) | - | 2030900..2031142 (-) | 243 | WP_011676960.1 | GlsB/YeaQ/YmgE family stress response membrane protein | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15693.35 Da Isoelectric Point: 5.1972
>NTDB_id=183034 LLJM3_RS10370 WP_011676939.1 2020847..2021272(-) (ssb) [Lactococcus cremoris strain JM3]
MINNVTLVGRITKEPELRYTQQNKAVASFTLAVNRAFKNANGEREADFINCVIWGKSAENLANWTHKGQLIGVTGSIQTR
NYENQQGQRVYITEVVASNFQVLEKSNQANGERVSNPASKPQNNDSFGSDPMEVSDDDLPF
MINNVTLVGRITKEPELRYTQQNKAVASFTLAVNRAFKNANGEREADFINCVIWGKSAENLANWTHKGQLIGVTGSIQTR
NYENQQGQRVYITEVVASNFQVLEKSNQANGERVSNPASKPQNNDSFGSDPMEVSDDDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=183034 LLJM3_RS10370 WP_011676939.1 2020847..2021272(-) (ssb) [Lactococcus cremoris strain JM3]
ATGATTAACAATGTCACTCTAGTAGGAAGAATCACTAAAGAACCTGAACTTAGATATACACAACAAAATAAAGCAGTTGC
TTCATTTACTCTTGCAGTTAATCGAGCATTTAAAAATGCTAATGGAGAAAGAGAAGCTGACTTTATCAATTGTGTTATTT
GGGGTAAATCAGCCGAAAACTTGGCCAATTGGACTCATAAAGGTCAATTAATTGGAGTTACTGGTAGTATTCAAACTCGA
AACTATGAGAACCAACAAGGGCAGCGTGTTTATATTACGGAGGTTGTCGCAAGTAATTTCCAAGTACTAGAAAAAAGTAA
TCAAGCAAATGGTGAACGAGTTAGTAATCCAGCTTCAAAACCACAAAATAACGATTCTTTTGGAAGTGATCCAATGGAAG
TTTCAGATGATGACCTACCATTCTAA
ATGATTAACAATGTCACTCTAGTAGGAAGAATCACTAAAGAACCTGAACTTAGATATACACAACAAAATAAAGCAGTTGC
TTCATTTACTCTTGCAGTTAATCGAGCATTTAAAAATGCTAATGGAGAAAGAGAAGCTGACTTTATCAATTGTGTTATTT
GGGGTAAATCAGCCGAAAACTTGGCCAATTGGACTCATAAAGGTCAATTAATTGGAGTTACTGGTAGTATTCAAACTCGA
AACTATGAGAACCAACAAGGGCAGCGTGTTTATATTACGGAGGTTGTCGCAAGTAATTTCCAAGTACTAGAAAAAAGTAA
TCAAGCAAATGGTGAACGAGTTAGTAATCCAGCTTCAAAACCACAAAATAACGATTCTTTTGGAAGTGATCCAATGGAAG
TTTCAGATGATGACCTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
52.353 |
100 |
0.631 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
50.581 |
100 |
0.617 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
43.262 |
100 |
0.433 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
42.553 |
100 |
0.426 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
42.553 |
100 |
0.426 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
42.553 |
100 |
0.426 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
42.553 |
100 |
0.426 |
| ssbB/cilA | Streptococcus mitis SK321 |
42.553 |
100 |
0.426 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
57.692 |
73.759 |
0.426 |
| ssbA | Streptococcus mutans UA159 |
39.007 |
100 |
0.39 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
50.485 |
73.05 |
0.369 |