Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | LL275_RS02535 | Genome accession | NZ_CP015897 |
| Coordinates | 483746..484171 (+) | Length | 141 a.a. |
| NCBI ID | WP_015967987.1 | Uniprot ID | A0A1V0NDX0 |
| Organism | Lactococcus lactis subsp. lactis strain 275 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 476712..513665 | 483746..484171 | within | 0 |
Gene organization within MGE regions
Location: 476712..513665
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LL275_RS02460 (LL275_0472) | - | 476712..477846 (-) | 1135 | Protein_466 | tyrosine-type recombinase/integrase | - |
| LL275_RS02465 (LL275_0473) | - | 477898..478758 (-) | 861 | WP_081144184.1 | S24 family peptidase | - |
| LL275_RS14825 | - | 479166..479294 (+) | 129 | WP_269466699.1 | hypothetical protein | - |
| LL275_RS02480 (LL275_0475) | - | 479522..479884 (-) | 363 | WP_081144188.1 | hypothetical protein | - |
| LL275_RS02485 (LL275_0476) | - | 479922..480131 (+) | 210 | WP_081144190.1 | hypothetical protein | - |
| LL275_RS02490 (LL275_0477) | - | 480156..480386 (+) | 231 | WP_015966797.1 | cro2009 | - |
| LL275_RS02495 (LL275_0478) | - | 480398..480616 (+) | 219 | WP_011834773.1 | hypothetical protein | - |
| LL275_RS02500 (LL275_0479) | - | 480626..481339 (+) | 714 | WP_081144192.1 | ORF6C domain-containing protein | - |
| LL275_RS02505 (LL275_0480) | - | 481352..481684 (+) | 333 | WP_081144194.1 | DUF771 domain-containing protein | - |
| LL275_RS02510 | - | 481822..482046 (+) | 225 | WP_032399005.1 | hypothetical protein | - |
| LL275_RS02515 (LL275_0482) | - | 482043..482237 (+) | 195 | WP_081144195.1 | hypothetical protein | - |
| LL275_RS02520 (LL275_0483) | - | 482247..482489 (+) | 243 | WP_032399006.1 | hypothetical protein | - |
| LL275_RS02525 (LL275_0484) | - | 482591..482986 (+) | 396 | WP_003132838.1 | hypothetical protein | - |
| LL275_RS02530 (LL275_0485) | - | 482995..483753 (+) | 759 | WP_081144196.1 | Rad52/Rad22 family DNA repair protein | - |
| LL275_RS02535 (LL275_0486) | ssb | 483746..484171 (+) | 426 | WP_015967987.1 | single-stranded DNA-binding protein | Machinery gene |
| LL275_RS02540 (LL275_0487) | - | 484296..485078 (+) | 783 | WP_023189114.1 | phage replisome organiser protein | - |
| LL275_RS02545 (LL275_0488) | - | 485078..485803 (+) | 726 | WP_081144197.1 | hypothetical protein | - |
| LL275_RS02550 (LL275_0489) | - | 485800..486189 (+) | 390 | WP_081144198.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LL275_RS02555 (LL275_0490) | - | 486192..486434 (+) | 243 | WP_081144199.1 | DUF1031 family protein | - |
| LL275_RS14480 (LL275_0491) | - | 486542..486697 (+) | 156 | WP_081144200.1 | hypothetical protein | - |
| LL275_RS02565 (LL275_0492) | - | 486687..487256 (+) | 570 | WP_081144201.1 | DUF658 family protein | - |
| LL275_RS02570 (LL275_0493) | - | 487450..487656 (+) | 207 | WP_010905356.1 | DUF1125 domain-containing protein | - |
| LL275_RS02575 (LL275_0494) | - | 487649..488341 (+) | 693 | WP_081144202.1 | DUF1642 domain-containing protein | - |
| LL275_RS02580 (LL275_0495) | - | 488338..488757 (+) | 420 | WP_081144203.1 | dUTP diphosphatase | - |
| LL275_RS14625 (LL275_0496) | - | 488760..489290 (+) | 531 | WP_237025330.1 | hypothetical protein | - |
| LL275_RS02595 (LL275_0497) | - | 489287..489967 (+) | 681 | WP_081144204.1 | hypothetical protein | - |
| LL275_RS02600 (LL275_0498) | - | 490014..490232 (+) | 219 | WP_015967997.1 | hypothetical protein | - |
| LL275_RS02605 (LL275_0499) | - | 490229..490429 (+) | 201 | WP_081144205.1 | DUF1660 domain-containing protein | - |
| LL275_RS02615 (LL275_0501) | - | 490610..490792 (+) | 183 | WP_015967999.1 | hypothetical protein | - |
| LL275_RS02620 (LL275_0502) | - | 490789..490968 (+) | 180 | WP_015968000.1 | hypothetical protein | - |
| LL275_RS02625 (LL275_0503) | - | 491106..491570 (+) | 465 | WP_015968001.1 | hypothetical protein | - |
| LL275_RS02630 (LL275_0505) | - | 491818..492240 (+) | 423 | WP_014573151.1 | RinA family protein | - |
| LL275_RS02640 (LL275_0506) | - | 492467..492673 (+) | 207 | WP_025017211.1 | helix-turn-helix transcriptional regulator | - |
| LL275_RS02645 (LL275_0507) | - | 492686..493189 (+) | 504 | WP_081144207.1 | HNH endonuclease | - |
| LL275_RS02650 (LL275_0508) | - | 493349..493744 (+) | 396 | WP_047687184.1 | phage terminase small subunit P27 family | - |
| LL275_RS02655 (LL275_0509) | - | 493744..495558 (+) | 1815 | WP_081144208.1 | terminase large subunit | - |
| LL275_RS14485 (LL275_0510) | - | 495567..495731 (+) | 165 | WP_058221580.1 | hypothetical protein | - |
| LL275_RS02665 (LL275_0511) | - | 495728..496807 (+) | 1080 | WP_023164518.1 | phage portal protein | - |
| LL275_RS02670 (LL275_0512) | - | 496816..497394 (+) | 579 | WP_306472235.1 | HK97 family phage prohead protease | - |
| LL275_RS02675 (LL275_0513) | - | 497384..498697 (+) | 1314 | WP_081144209.1 | phage major capsid protein | - |
| LL275_RS02680 (LL275_0514) | - | 498708..499013 (+) | 306 | WP_081144210.1 | head-tail connector protein | - |
| LL275_RS02685 (LL275_0515) | - | 499000..499335 (+) | 336 | WP_081144211.1 | phage head closure protein | - |
| LL275_RS02690 (LL275_0516) | - | 499335..499817 (+) | 483 | WP_237025331.1 | HK97 gp10 family phage protein | - |
| LL275_RS02695 (LL275_0517) | - | 499814..500209 (+) | 396 | WP_010905383.1 | DUF806 family protein | - |
| LL275_RS02700 (LL275_0518) | - | 500211..500816 (+) | 606 | WP_081144213.1 | phage tail protein | - |
| LL275_RS02705 (LL275_0519) | - | 500876..501220 (+) | 345 | WP_081144214.1 | phage tail tube assembly chaperone | - |
| LL275_RS14350 | - | 501238..501408 (+) | 171 | WP_021166226.1 | hypothetical protein | - |
| LL275_RS02710 (LL275_0520) | - | 501426..505229 (+) | 3804 | WP_237025332.1 | tape measure protein | - |
| LL275_RS02715 (LL275_0521) | - | 505232..506776 (+) | 1545 | WP_081144216.1 | distal tail protein Dit | - |
| LL275_RS14630 (LL275_0522) | - | 506776..511743 (+) | 4968 | WP_237025333.1 | hypothetical protein | - |
| LL275_RS02730 (LL275_0523) | - | 511755..511991 (+) | 237 | WP_081144217.1 | hypothetical protein | - |
| LL275_RS02735 (LL275_0524) | - | 512004..512354 (+) | 351 | WP_014570798.1 | hypothetical protein | - |
| LL275_RS02740 (LL275_0525) | - | 512367..512666 (+) | 300 | WP_010905918.1 | phage holin | - |
| LL275_RS02745 (LL275_0526) | - | 512668..512886 (+) | 219 | WP_081144218.1 | hypothetical protein | - |
| LL275_RS02750 (LL275_0527) | - | 512886..513665 (+) | 780 | WP_081144219.1 | peptidoglycan amidohydrolase family protein | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15716.47 Da Isoelectric Point: 5.1972
>NTDB_id=182870 LL275_RS02535 WP_015967987.1 483746..484171(+) (ssb) [Lactococcus lactis subsp. lactis strain 275]
MINNVTLVGRITKEPELRYTPQNKAVATFTLAVNRAFKNANGEREADFISCVIWGKSAENLANWTHKGQLIGVIGNIQTR
NYENQQGQRVYITEVVASNFQVLEKSNQANGERISNPASKPQNNDSFGSDPMEISDDDLPF
MINNVTLVGRITKEPELRYTPQNKAVATFTLAVNRAFKNANGEREADFISCVIWGKSAENLANWTHKGQLIGVIGNIQTR
NYENQQGQRVYITEVVASNFQVLEKSNQANGERISNPASKPQNNDSFGSDPMEISDDDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=182870 LL275_RS02535 WP_015967987.1 483746..484171(+) (ssb) [Lactococcus lactis subsp. lactis strain 275]
ATGATTAACAATGTCACTCTAGTAGGGCGAATCACTAAAGAACCTGAACTTAGATATACACCACAAAATAAAGCAGTTGC
CACTTTTACTCTTGCAGTTAATCGAGCATTTAAAAACGCTAATGGAGAAAGAGAAGCTGACTTTATCAGTTGTGTTATTT
GGGGTAAATCAGCCGAAAACTTGGCCAATTGGACTCATAAAGGTCAATTAATTGGAGTTATTGGGAATATCCAGACTCGA
AACTATGAGAACCAACAAGGGCAGCGTGTTTATATTACGGAGGTTGTCGCAAGTAATTTCCAAGTACTAGAAAAAAGTAA
TCAAGCAAATGGTGAACGAATTAGTAATCCAGCTTCAAAACCACAAAATAATGATTCTTTTGGAAGTGATCCAATGGAAA
TTTCAGATGATGACCTACCATTTTAA
ATGATTAACAATGTCACTCTAGTAGGGCGAATCACTAAAGAACCTGAACTTAGATATACACCACAAAATAAAGCAGTTGC
CACTTTTACTCTTGCAGTTAATCGAGCATTTAAAAACGCTAATGGAGAAAGAGAAGCTGACTTTATCAGTTGTGTTATTT
GGGGTAAATCAGCCGAAAACTTGGCCAATTGGACTCATAAAGGTCAATTAATTGGAGTTATTGGGAATATCCAGACTCGA
AACTATGAGAACCAACAAGGGCAGCGTGTTTATATTACGGAGGTTGTCGCAAGTAATTTCCAAGTACTAGAAAAAAGTAA
TCAAGCAAATGGTGAACGAATTAGTAATCCAGCTTCAAAACCACAAAATAATGATTCTTTTGGAAGTGATCCAATGGAAA
TTTCAGATGATGACCTACCATTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
52.941 |
100 |
0.638 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
51.744 |
100 |
0.631 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
42.553 |
100 |
0.426 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
42.553 |
100 |
0.426 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
42.553 |
100 |
0.426 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
56.731 |
73.759 |
0.418 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
41.844 |
100 |
0.418 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
41.844 |
100 |
0.418 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
41.844 |
100 |
0.418 |
| ssbB/cilA | Streptococcus mitis SK321 |
41.844 |
100 |
0.418 |
| ssbA | Streptococcus mutans UA159 |
39.007 |
100 |
0.39 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
51.456 |
73.05 |
0.376 |