Detailed information
Bioinformatically predicted
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | A4V06_RS11740 | Genome accession | NZ_CP015410 |
| Coordinates | 2369411..2369686 (-) | Length | 91 a.a. |
| NCBI ID | WP_002380445.1 | Uniprot ID | - |
| Organism | Enterococcus faecalis strain KB1 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 2364411..2374686
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A4V06_RS11705 (A4V06_09425) | - | 2364966..2365439 (+) | 474 | WP_002357065.1 | universal stress protein | - |
| A4V06_RS11710 (A4V06_09430) | - | 2365551..2366738 (-) | 1188 | WP_002357064.1 | acetate/propionate family kinase | - |
| A4V06_RS11715 (A4V06_09435) | - | 2366763..2367770 (-) | 1008 | WP_002380426.1 | class I SAM-dependent methyltransferase | - |
| A4V06_RS11720 (A4V06_09440) | comGG | 2367899..2368252 (-) | 354 | WP_002362054.1 | competence type IV pilus minor pilin ComGG | - |
| A4V06_RS11725 (A4V06_09445) | comGF | 2368252..2368686 (-) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| A4V06_RS11730 (A4V06_09450) | - | 2368676..2369002 (-) | 327 | WP_010774640.1 | type II secretion system protein | - |
| A4V06_RS11735 (A4V06_09455) | comGD | 2368968..2369414 (-) | 447 | WP_002379576.1 | competence type IV pilus minor pilin ComGD | - |
| A4V06_RS11740 (A4V06_09460) | comGC/cglC | 2369411..2369686 (-) | 276 | WP_002380445.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| A4V06_RS11745 (A4V06_09465) | comGB | 2369686..2370732 (-) | 1047 | WP_002369171.1 | competence type IV pilus assembly protein ComGB | - |
| A4V06_RS11750 (A4V06_09470) | comGA | 2370689..2371657 (-) | 969 | WP_002364362.1 | competence type IV pilus ATPase ComGA | - |
| A4V06_RS11755 (A4V06_09475) | - | 2371898..2373226 (-) | 1329 | WP_002362058.1 | APC family permease | - |
| A4V06_RS11765 (A4V06_09480) | rlmN | 2373516..2374589 (-) | 1074 | WP_002356987.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10465.36 Da Isoelectric Point: 7.0118
>NTDB_id=179282 A4V06_RS11740 WP_002380445.1 2369411..2369686(-) (comGC/cglC) [Enterococcus faecalis strain KB1]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDEKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDEKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=179282 A4V06_RS11740 WP_002380445.1 2369411..2369686(-) (comGC/cglC) [Enterococcus faecalis strain KB1]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATGAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATGAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
56.977 |
94.505 |
0.538 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus suis isolate S10 |
51.163 |
94.505 |
0.484 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
45.055 |
100 |
0.451 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
47.297 |
81.319 |
0.385 |