Detailed information NTG0174716

Bioinformatically predicted

Overview

• Name: ssbA
• Type: Machinery gene
• Locus tag: A3L20_RS11535
• Genome accession: NZ_CP014847
• Coordinates: 2228810..2229145 (+)
• Length: 111 a.a.
• NCBI ID: WP_000982013.1
• Uniprot ID: A0A9X6LR10
• Organism: Bacillus thuringiensis strain HD12
• Function: ssDNA binding (predicted from homology) DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
IS/Tn	2226796..2228025	2228810..2229145	flank	785

Gene organization within MGE regions

Location: 2226796..2229145

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
A3L20_RS11525 (A3L20_11525)	-	2226796..2228025 (-)	1230	WP_001236353.1	IS110 family transposase	-
A3L20_RS11530 (A3L20_11530)	-	2228394..2228648 (+)	255	WP_016077798.1	DUF4318 domain-containing protein	-
A3L20_RS11535 (A3L20_11535)	ssbA	2228810..2229145 (+)	336	WP_000982013.1	single-stranded DNA-binding protein	Machinery gene

Sequence

Protein

• Length: 111 a.a.
• Molecular weight: 12785.64 Da
• Isoelectric Point: 9.4344

>NTDB_id=174716 A3L20_RS11535 WP_000982013.1 2228810..2229145(+) (ssbA) [Bacillus thuringiensis strain HD12]
MMNRVVLIGRLTKEPELYYTKQGVAYARICIAVNRGFRNSLGEQQVDFINCVVWRKSAENVTEYCKKGSLVGITGRIQTS
NYDDEQGKRIYRTEVVIESITFLERRREGAS

Nucleotide

• Length: 336 bp

>NTDB_id=174716 A3L20_RS11535 WP_000982013.1 2228810..2229145(+) (ssbA) [Bacillus thuringiensis strain HD12]
ATGATGAATCGAGTTGTATTAATCGGTAGATTGACAAAGGAGCCAGAATTATACTACACAAAACAAGGCGTCGCTTATGC
AAGAATATGTATTGCGGTGAATAGAGGATTTCGAAATAGTTTAGGTGAACAACAAGTCGATTTTATTAATTGTGTCGTTT
GGCGAAAATCGGCTGAGAATGTAACTGAATATTGTAAGAAGGGGTCACTTGTTGGGATTACAGGGCGTATTCAGACGAGT
AATTACGATGATGAACAAGGCAAGAGAATATATAGAACTGAAGTTGTGATTGAGAGTATTACCTTTTTGGAGAGAAGGCG
GGAGGGGGCATCATGA

Domains

Predicted by InterproScan.

• Single-strand binding protein family (SSB) (2-103)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
ssbA	Bacillus subtilis subsp. subtilis str. 168	58.491	95.495	0.559
ssb	Latilactobacillus sakei subsp. sakei 23K	55.66	95.495	0.532
ssbB	Bacillus subtilis subsp. subtilis str. 168	50.893	100	0.514
ssbB	Lactococcus lactis subsp. cremoris KW2	45.714	94.595	0.432
ssbB	Streptococcus sobrinus strain NIDR 6715-7	43.636	99.099	0.432
ssbB/cilA	Streptococcus mitis NCTC 12261	40.909	99.099	0.405
ssbB/cilA	Streptococcus pneumoniae TIGR4	40.909	99.099	0.405
ssbB/cilA	Streptococcus pneumoniae Rx1	40	99.099	0.396
ssbB/cilA	Streptococcus pneumoniae D39	40	99.099	0.396
ssbB/cilA	Streptococcus pneumoniae R6	40	99.099	0.396
ssbB/cilA	Streptococcus mitis SK321	40	99.099	0.396
ssbA	Streptococcus mutans UA159	40	99.099	0.396