Detailed information
Overview
| Name | ssbB | Type | Machinery gene |
| Locus tag | GT3570_RS15645 | Genome accession | NZ_CP014335 |
| Coordinates | 3101363..3101722 (-) | Length | 119 a.a. |
| NCBI ID | WP_011232661.1 | Uniprot ID | U2WRT9 |
| Organism | Geobacillus thermoleovorans strain KCTC 3570 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 3084987..3107474 | 3101363..3101722 | within | 0 |
Gene organization within MGE regions
Location: 3084987..3107474
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GT3570_RS15560 (GT3570_15560) | istB | 3084987..3085739 (-) | 753 | WP_011230286.1 | IS21-like element helper ATPase IstB | - |
| GT3570_RS15565 (GT3570_15565) | istA | 3085736..3087241 (-) | 1506 | WP_011230285.1 | IS21 family transposase | - |
| GT3570_RS15570 (GT3570_15570) | - | 3087383..3087889 (+) | 507 | Protein_3092 | IS982-like element ISGsp1 family transposase | - |
| GT3570_RS15575 (GT3570_15575) | istB | 3087893..3088624 (-) | 732 | WP_062898979.1 | IS21-like element helper ATPase IstB | - |
| GT3570_RS15580 (GT3570_15580) | - | 3088621..3089283 (-) | 663 | WP_062898980.1 | Mu transposase domain-containing protein | - |
| GT3570_RS19200 (GT3570_15585) | - | 3089494..3090057 (+) | 564 | WP_011229674.1 | DUF6431 domain-containing protein | - |
| GT3570_RS15590 (GT3570_15590) | - | 3090200..3090505 (+) | 306 | Protein_3096 | helix-turn-helix domain-containing protein | - |
| GT3570_RS15595 (GT3570_15595) | - | 3090580..3090906 (+) | 327 | WP_011229672.1 | transposase | - |
| GT3570_RS15600 (GT3570_15600) | - | 3090885..3091766 (+) | 882 | Protein_3098 | IS3 family transposase | - |
| GT3570_RS15605 (GT3570_15605) | - | 3091946..3092890 (+) | 945 | Protein_3099 | DDE-type integrase/transposase/recombinase | - |
| GT3570_RS15610 (GT3570_15610) | - | 3092883..3093683 (+) | 801 | WP_011229854.1 | ExeA family protein | - |
| GT3570_RS15615 (GT3570_15615) | - | 3093926..3094435 (-) | 510 | WP_062898981.1 | RadC family protein | - |
| GT3570_RS15620 (GT3570_15620) | - | 3094739..3097381 (-) | 2643 | WP_062898982.1 | Ig-like domain-containing protein | - |
| GT3570_RS15625 (GT3570_15625) | - | 3097754..3098533 (-) | 780 | WP_062898983.1 | hypothetical protein | - |
| GT3570_RS15630 (GT3570_15630) | - | 3098579..3099934 (-) | 1356 | WP_062898984.1 | peptidoglycan-binding protein | - |
| GT3570_RS15635 (GT3570_15635) | - | 3100117..3100626 (-) | 510 | WP_011232659.1 | hypothetical protein | - |
| GT3570_RS15640 (GT3570_15640) | - | 3100835..3101242 (+) | 408 | WP_062898985.1 | helix-turn-helix domain-containing protein | - |
| GT3570_RS15645 (GT3570_15645) | ssbB | 3101363..3101722 (-) | 360 | WP_011232661.1 | single-stranded DNA-binding protein | Machinery gene |
| GT3570_RS15650 (GT3570_15650) | - | 3101992..3102432 (+) | 441 | WP_013146485.1 | YwpF-like family protein | - |
| GT3570_RS15655 (GT3570_15655) | - | 3102489..3103118 (-) | 630 | WP_014196837.1 | class D sortase | - |
| GT3570_RS15660 (GT3570_15660) | - | 3103125..3104024 (-) | 900 | WP_062898986.1 | processed acidic surface protein | - |
| GT3570_RS15665 (GT3570_15665) | - | 3104405..3105781 (-) | 1377 | WP_042379307.1 | aspartate kinase | - |
| GT3570_RS15675 (GT3570_15675) | - | 3106059..3106493 (-) | 435 | WP_025039145.1 | DUF1284 domain-containing protein | - |
| GT3570_RS15680 (GT3570_15680) | - | 3106887..3107474 (+) | 588 | WP_014196843.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 119 a.a. Molecular weight: 13427.38 Da Isoelectric Point: 9.8293
>NTDB_id=170421 GT3570_RS15645 WP_011232661.1 3101363..3101722(-) (ssbB) [Geobacillus thermoleovorans strain KCTC 3570]
MRQHMINQVVLVGRLTKDPELRYTAEGAAVATVTLAVARNFRNAEGGIDADFVPCVLWRKTAEHTANYCRKGSMVAVTGR
IQTRRYDKKDGQRVYVTEVVAESVQFLHSGKKPEWPEHV
MRQHMINQVVLVGRLTKDPELRYTAEGAAVATVTLAVARNFRNAEGGIDADFVPCVLWRKTAEHTANYCRKGSMVAVTGR
IQTRRYDKKDGQRVYVTEVVAESVQFLHSGKKPEWPEHV
Nucleotide
Download Length: 360 bp
>NTDB_id=170421 GT3570_RS15645 WP_011232661.1 3101363..3101722(-) (ssbB) [Geobacillus thermoleovorans strain KCTC 3570]
ATGCGCCAACACATGATCAACCAAGTCGTGTTGGTCGGCCGGTTGACGAAAGATCCCGAGCTTCGCTACACGGCCGAAGG
GGCTGCCGTCGCGACTGTCACGCTGGCGGTGGCGAGAAATTTCCGCAACGCGGAAGGGGGGATTGACGCCGATTTCGTTC
CATGCGTTTTATGGCGGAAAACAGCGGAACATACCGCCAATTATTGCCGAAAAGGATCGATGGTGGCGGTGACGGGGAGA
ATCCAAACGCGCCGCTACGATAAAAAAGACGGTCAACGCGTCTATGTCACCGAAGTCGTCGCGGAGTCCGTCCAATTTCT
CCACTCCGGAAAGAAACCAGAATGGCCGGAGCACGTATAG
ATGCGCCAACACATGATCAACCAAGTCGTGTTGGTCGGCCGGTTGACGAAAGATCCCGAGCTTCGCTACACGGCCGAAGG
GGCTGCCGTCGCGACTGTCACGCTGGCGGTGGCGAGAAATTTCCGCAACGCGGAAGGGGGGATTGACGCCGATTTCGTTC
CATGCGTTTTATGGCGGAAAACAGCGGAACATACCGCCAATTATTGCCGAAAAGGATCGATGGTGGCGGTGACGGGGAGA
ATCCAAACGCGCCGCTACGATAAAAAAGACGGTCAACGCGTCTATGTCACCGAAGTCGTCGCGGAGTCCGTCCAATTTCT
CCACTCCGGAAAGAAACCAGAATGGCCGGAGCACGTATAG
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
67.961 |
86.555 |
0.588 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
65.385 |
87.395 |
0.571 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
60 |
88.235 |
0.529 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
48.571 |
88.235 |
0.429 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
46.667 |
88.235 |
0.412 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
46.667 |
88.235 |
0.412 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
45.714 |
88.235 |
0.403 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
45.714 |
88.235 |
0.403 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
45.714 |
88.235 |
0.403 |
| ssbB/cilA | Streptococcus mitis SK321 |
45.714 |
88.235 |
0.403 |
| ssbA | Streptococcus mutans UA159 |
45.714 |
88.235 |
0.403 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
42.308 |
87.395 |
0.37 |