Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | AUQ45_RS03275 | Genome accession | NZ_CP013672 |
| Coordinates | 637246..637638 (-) | Length | 130 a.a. |
| NCBI ID | WP_011017370.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain AP53 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 597423..649467 | 637246..637638 | within | 0 |
Gene organization within MGE regions
Location: 597423..649467
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AUQ45_RS03040 (AUQ45_0585) | dnaG | 597441..599210 (+) | 1770 | WP_050804381.1 | DNA primase | - |
| AUQ45_RS03045 (AUQ45_0586) | rpoD | 599219..600328 (+) | 1110 | WP_002985187.1 | RNA polymerase sigma factor RpoD | - |
| AUQ45_RS03050 (AUQ45_0587) | - | 600564..600902 (+) | 339 | WP_002990295.1 | metal-sulfur cluster assembly factor | - |
| AUQ45_RS03055 (AUQ45_0588) | rfbD | 601040..601894 (+) | 855 | WP_002992705.1 | dTDP-4-dehydrorhamnose reductase | - |
| AUQ45_RS03060 (AUQ45_0589) | cps2T | 602013..603167 (+) | 1155 | WP_002985181.1 | beta 1-4 rhamnosyltransferase Cps2T | - |
| AUQ45_RS03065 (AUQ45_0590) | - | 603157..604089 (+) | 933 | WP_002992707.1 | glycosyltransferase family 2 protein | - |
| AUQ45_RS03070 (AUQ45_0591) | - | 604092..604895 (+) | 804 | WP_002985178.1 | ABC transporter permease | - |
| AUQ45_RS03075 (AUQ45_0592) | - | 604895..606100 (+) | 1206 | WP_002985176.1 | ABC transporter ATP-binding protein | - |
| AUQ45_RS03080 (AUQ45_0593) | - | 606125..607132 (+) | 1008 | WP_014635391.1 | glycosyltransferase | - |
| AUQ45_RS03085 (AUQ45_0594) | - | 607129..608874 (+) | 1746 | WP_002985173.1 | rhamnan synthesis F family protein | - |
| AUQ45_RS03090 (AUQ45_0595) | - | 608871..609560 (+) | 690 | Protein_569 | LTA synthase family protein | - |
| AUQ45_RS03095 (AUQ45_1866) | prx | 609612..609794 (-) | 183 | WP_029714017.1 | hypothetical protein | Regulator |
| AUQ45_RS03100 (AUQ45_0596) | - | 609993..610202 (-) | 210 | WP_048327315.1 | helix-turn-helix domain-containing protein | - |
| AUQ45_RS09950 (AUQ45_0597) | - | 610356..610502 (+) | 147 | WP_164406938.1 | hypothetical protein | - |
| AUQ45_RS03105 (AUQ45_0598) | - | 610643..610894 (+) | 252 | WP_048327312.1 | hypothetical protein | - |
| AUQ45_RS03110 (AUQ45_0599) | - | 611158..611397 (+) | 240 | WP_011054447.1 | hypothetical protein | - |
| AUQ45_RS03115 (AUQ45_0600) | - | 611455..611811 (+) | 357 | WP_011054446.1 | hypothetical protein | - |
| AUQ45_RS03120 (AUQ45_0601) | - | 611927..613135 (-) | 1209 | WP_011054445.1 | glucosaminidase domain-containing protein | - |
| AUQ45_RS03125 | - | 613251..613478 (-) | 228 | WP_011054444.1 | phage holin | - |
| AUQ45_RS03130 | - | 613475..613747 (-) | 273 | WP_011017397.1 | hypothetical protein | - |
| AUQ45_RS03135 (AUQ45_0604) | - | 613759..614391 (-) | 633 | WP_011054443.1 | hypothetical protein | - |
| AUQ45_RS03140 (AUQ45_0605) | - | 614394..614822 (-) | 429 | WP_063265937.1 | DUF1617 family protein | - |
| AUQ45_RS03145 (AUQ45_0606) | - | 614834..616738 (-) | 1905 | WP_011017395.1 | gp58-like family protein | - |
| AUQ45_RS03150 (AUQ45_0607) | - | 616748..617755 (-) | 1008 | WP_011017394.1 | hyaluronoglucosaminidase | - |
| AUQ45_RS03155 (AUQ45_0608) | - | 617752..619803 (-) | 2052 | WP_063265938.1 | phage tail spike protein | - |
| AUQ45_RS03160 (AUQ45_0609) | - | 619800..620570 (-) | 771 | WP_011017392.1 | distal tail protein Dit | - |
| AUQ45_RS03165 (AUQ45_0610) | - | 620583..624683 (-) | 4101 | WP_063265939.1 | phage tail tape measure protein | - |
| AUQ45_RS03170 (AUQ45_0612) | gpG | 624909..625211 (-) | 303 | WP_011017390.1 | phage tail assembly chaperone G | - |
| AUQ45_RS03175 (AUQ45_0613) | - | 625304..625888 (-) | 585 | WP_011017389.1 | major tail protein | - |
| AUQ45_RS03180 (AUQ45_0614) | - | 625900..626280 (-) | 381 | WP_011017388.1 | hypothetical protein | - |
| AUQ45_RS03185 (AUQ45_0615) | - | 626273..626671 (-) | 399 | WP_011017387.1 | HK97 gp10 family phage protein | - |
| AUQ45_RS03190 (AUQ45_0616) | - | 626673..627035 (-) | 363 | WP_011017386.1 | hypothetical protein | - |
| AUQ45_RS03195 (AUQ45_0617) | - | 627028..627336 (-) | 309 | WP_011017385.1 | hypothetical protein | - |
| AUQ45_RS09955 (AUQ45_0618) | - | 627336..627509 (-) | 174 | WP_011017384.1 | hypothetical protein | - |
| AUQ45_RS03200 (AUQ45_0619) | - | 627523..628656 (-) | 1134 | WP_011017383.1 | phage major capsid protein | - |
| AUQ45_RS03205 (AUQ45_0620) | - | 628673..629479 (-) | 807 | WP_011017382.1 | head maturation protease, ClpP-related | - |
| AUQ45_RS03210 (AUQ45_0621) | - | 629460..630647 (-) | 1188 | WP_011017381.1 | phage portal protein | - |
| AUQ45_RS03215 | - | 630800..631012 (-) | 213 | WP_136260634.1 | hypothetical protein | - |
| AUQ45_RS03220 (AUQ45_0622) | - | 631015..632745 (-) | 1731 | WP_011017380.1 | terminase large subunit domain-containing protein | - |
| AUQ45_RS03225 (AUQ45_0623) | - | 632758..633075 (-) | 318 | WP_011017379.1 | P27 family phage terminase small subunit | - |
| AUQ45_RS03230 | - | 633216..633521 (-) | 306 | WP_063265940.1 | HNH endonuclease | - |
| AUQ45_RS03235 (AUQ45_0625) | - | 633514..633900 (-) | 387 | WP_011017377.1 | hypothetical protein | - |
| AUQ45_RS03240 (AUQ45_0626) | - | 633926..634129 (-) | 204 | WP_011017376.1 | hypothetical protein | - |
| AUQ45_RS03245 (AUQ45_0627) | - | 634187..634480 (-) | 294 | WP_011017375.1 | hypothetical protein | - |
| AUQ45_RS03250 (AUQ45_0628) | - | 634634..635209 (-) | 576 | WP_011054435.1 | site-specific integrase | - |
| AUQ45_RS03255 (AUQ45_0629) | - | 635369..635770 (-) | 402 | WP_011017373.1 | hypothetical protein | - |
| AUQ45_RS03260 (AUQ45_0630) | - | 635785..636612 (-) | 828 | WP_011017372.1 | prohibitin family protein | - |
| AUQ45_RS03265 (AUQ45_0631) | - | 636615..636953 (-) | 339 | WP_011017371.1 | helix-turn-helix domain-containing protein | - |
| AUQ45_RS03270 (AUQ45_0632) | - | 636950..637231 (-) | 282 | WP_011054431.1 | hypothetical protein | - |
| AUQ45_RS03275 (AUQ45_0633) | ssbA | 637246..637638 (-) | 393 | WP_011017370.1 | single-stranded DNA-binding protein | Machinery gene |
| AUQ45_RS03280 (AUQ45_0634) | - | 637635..637856 (-) | 222 | WP_011017369.1 | hypothetical protein | - |
| AUQ45_RS03285 (AUQ45_0635) | - | 637853..638338 (-) | 486 | WP_011017368.1 | DUF1642 domain-containing protein | - |
| AUQ45_RS03290 (AUQ45_0636) | - | 638343..638975 (-) | 633 | WP_023611652.1 | N-6 DNA methylase | - |
| AUQ45_RS03295 (AUQ45_0637) | - | 638977..639246 (-) | 270 | WP_011017366.1 | hypothetical protein | - |
| AUQ45_RS09960 (AUQ45_0638) | - | 639243..639413 (-) | 171 | WP_023611649.1 | hypothetical protein | - |
| AUQ45_RS03300 (AUQ45_0639) | - | 639410..639853 (-) | 444 | WP_011017365.1 | YopX family protein | - |
| AUQ45_RS10260 (AUQ45_0640) | - | 639870..639995 (-) | 126 | WP_257000584.1 | hypothetical protein | - |
| AUQ45_RS03305 (AUQ45_0641) | - | 640009..640236 (-) | 228 | WP_032467212.1 | hypothetical protein | - |
| AUQ45_RS03310 (AUQ45_0642) | - | 640236..641048 (-) | 813 | WP_063265941.1 | ATP-binding protein | - |
| AUQ45_RS03315 (AUQ45_0643) | - | 641048..641809 (-) | 762 | WP_011017361.1 | conserved phage C-terminal domain-containing protein | - |
| AUQ45_RS03320 (AUQ45_0644) | dnaB | 641802..643142 (-) | 1341 | WP_011017360.1 | replicative DNA helicase | - |
| AUQ45_RS03325 | - | 643129..643317 (-) | 189 | WP_032461348.1 | hypothetical protein | - |
| AUQ45_RS03330 (AUQ45_0646) | - | 643438..643629 (-) | 192 | WP_011017359.1 | hypothetical protein | - |
| AUQ45_RS03335 (AUQ45_0647) | - | 643722..643979 (-) | 258 | WP_011054421.1 | hypothetical protein | - |
| AUQ45_RS03340 (AUQ45_0648) | - | 644053..644772 (-) | 720 | WP_011017357.1 | ORF6C domain-containing protein | - |
| AUQ45_RS03345 | - | 644824..645324 (+) | 501 | WP_032464978.1 | hypothetical protein | - |
| AUQ45_RS10265 (AUQ45_0649) | - | 645444..645578 (-) | 135 | WP_011017356.1 | hypothetical protein | - |
| AUQ45_RS03350 (AUQ45_0650) | - | 645652..645864 (-) | 213 | WP_011054420.1 | helix-turn-helix domain-containing protein | - |
| AUQ45_RS03355 (AUQ45_0651) | - | 645899..646174 (-) | 276 | WP_011017354.1 | hypothetical protein | - |
| AUQ45_RS03360 (AUQ45_0652) | - | 646463..646813 (+) | 351 | WP_011017353.1 | helix-turn-helix domain-containing protein | - |
| AUQ45_RS03365 (AUQ45_0653) | - | 646817..647209 (+) | 393 | WP_011017352.1 | ImmA/IrrE family metallo-endopeptidase | - |
| AUQ45_RS03370 (AUQ45_0654) | - | 647220..647960 (+) | 741 | WP_011017351.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| AUQ45_RS03375 (AUQ45_0655) | - | 648271..649467 (+) | 1197 | WP_011017350.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 130 a.a. Molecular weight: 14755.61 Da Isoelectric Point: 6.3209
>NTDB_id=163791 AUQ45_RS03275 WP_011017370.1 637246..637638(-) (ssbA) [Streptococcus pyogenes strain AP53]
MINNVVLIGRLTKDVELRYTPSQVACAQFTLAVNRNFKNQDGQKEADFINCVIWRKSAENLSNWAKKGQLIAITGRIQTR
NYENQQGQRVYVTEVVAESFQILEKRDNTANTSSLADSMPDYGPEPDLPF
MINNVVLIGRLTKDVELRYTPSQVACAQFTLAVNRNFKNQDGQKEADFINCVIWRKSAENLSNWAKKGQLIAITGRIQTR
NYENQQGQRVYVTEVVAESFQILEKRDNTANTSSLADSMPDYGPEPDLPF
Nucleotide
Download Length: 393 bp
>NTDB_id=163791 AUQ45_RS03275 WP_011017370.1 637246..637638(-) (ssbA) [Streptococcus pyogenes strain AP53]
ATGATCAATAACGTTGTTTTGATTGGCCGCTTAACAAAAGATGTTGAGCTACGCTATACACCAAGTCAAGTAGCTTGCGC
ACAGTTTACTTTAGCAGTTAATCGTAATTTTAAAAATCAAGATGGGCAAAAAGAGGCTGACTTTATCAATTGTGTCATCT
GGCGAAAGTCTGCCGAGAATTTATCAAACTGGGCTAAAAAAGGGCAATTGATTGCAATAACAGGACGCATACAGACTCGT
AATTATGAAAACCAGCAAGGACAACGTGTCTATGTTACGGAAGTTGTCGCAGAAAGCTTCCAGATTTTGGAGAAGCGTGA
TAACACTGCAAACACAAGCAGTTTAGCTGATAGCATGCCAGACTATGGACCAGAACCAGATTTACCATTTTAG
ATGATCAATAACGTTGTTTTGATTGGCCGCTTAACAAAAGATGTTGAGCTACGCTATACACCAAGTCAAGTAGCTTGCGC
ACAGTTTACTTTAGCAGTTAATCGTAATTTTAAAAATCAAGATGGGCAAAAAGAGGCTGACTTTATCAATTGTGTCATCT
GGCGAAAGTCTGCCGAGAATTTATCAAACTGGGCTAAAAAAGGGCAATTGATTGCAATAACAGGACGCATACAGACTCGT
AATTATGAAAACCAGCAAGGACAACGTGTCTATGTTACGGAAGTTGTCGCAGAAAGCTTCCAGATTTTGGAGAAGCGTGA
TAACACTGCAAACACAAGCAGTTTAGCTGATAGCATGCCAGACTATGGACCAGAACCAGATTTACCATTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
68.224 |
82.308 |
0.562 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
66.972 |
83.846 |
0.562 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
48.148 |
100 |
0.5 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
44.853 |
100 |
0.469 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
44.853 |
100 |
0.469 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
44.118 |
100 |
0.462 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
44.118 |
100 |
0.462 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
44.118 |
100 |
0.462 |
| ssbB/cilA | Streptococcus mitis SK321 |
43.704 |
100 |
0.454 |
| ssbA | Streptococcus mutans UA159 |
43.704 |
100 |
0.454 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
53.774 |
81.538 |
0.438 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
42.636 |
99.231 |
0.423 |