Detailed information NTG0141248

Bioinformatically predicted

Overview

• Name: comYC
• Type: Machinery gene
• Locus tag: MNA02_RS08870
• Genome accession: NZ_CP010999
• Coordinates: 1693634..1693960 (-)
• Length: 108 a.a.
• NCBI ID: WP_002946126.1
• Uniprot ID: A0A0E2Q1B3
• Organism: Streptococcus thermophilus strain MN-BM-A02
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1688634..1698960

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
MNA02_RS11810 (MNA02_1812)	-	1688899..1689237 (-)	339	WP_224103197.1	CPBP family intramembrane glutamic endopeptidase	-
MNA02_RS11815	-	1689281..1689556 (-)	276	WP_011681681.1	hypothetical protein	-
MNA02_RS08835	-	1689568..1689766 (-)	199	Protein_1676	helix-turn-helix transcriptional regulator	-
MNA02_RS08840 (MNA02_1815)	-	1690015..1691208 (-)	1194	WP_014608740.1	acetate kinase	-
MNA02_RS08845 (MNA02_1816)	comYH	1691264..1692220 (-)	957	WP_011681684.1	class I SAM-dependent methyltransferase	Machinery gene
MNA02_RS08850	comGG	1692265..1692582 (-)	318	WP_011681685.1	competence type IV pilus minor pilin ComGG	-
MNA02_RS08855 (MNA02_1818)	comYF	1692560..1692997 (-)	438	WP_011681686.1	competence type IV pilus minor pilin ComGF	Machinery gene
MNA02_RS08860	comGE	1692981..1693274 (-)	294	WP_024704238.1	competence type IV pilus minor pilin ComGE	-
MNA02_RS08865 (MNA02_1820)	comYD	1693246..1693674 (-)	429	WP_011226626.1	competence type IV pilus minor pilin ComGD	Machinery gene
MNA02_RS08870 (MNA02_1821)	comYC	1693634..1693960 (-)	327	WP_002946126.1	competence type IV pilus major pilin ComGC	Machinery gene
MNA02_RS08875 (MNA02_1822)	comYB	1693957..1695057 (-)	1101	WP_120764773.1	competence type IV pilus assembly protein ComGB	Machinery gene
MNA02_RS08880 (MNA02_1823)	comGA/cglA/cilD	1694939..1695880 (-)	942	WP_022096896.1	competence type IV pilus ATPase ComGA	Machinery gene
MNA02_RS08885 (MNA02_1824)	-	1695961..1696323 (-)	363	WP_014622006.1	DUF1033 family protein	-

Sequence

Protein

• Length: 108 a.a.
• Molecular weight: 11914.00 Da
• Isoelectric Point: 9.9219

>NTDB_id=141248 MNA02_RS08870 WP_002946126.1 1693634..1693960(-) (comYC) [Streptococcus thermophilus strain MN-BM-A02]
MKLMLKKLNAVKLRAFTLIEMLVVLLIISILLLLFVPNLSKQKDSVKETGNAAVVKVVDSQAELYEMKNNKTASLAALVS
EGQITQKQADSYNDYYAKHGGESRSVAN

Nucleotide

• Length: 327 bp

>NTDB_id=141248 MNA02_RS08870 WP_002946126.1 1693634..1693960(-) (comYC) [Streptococcus thermophilus strain MN-BM-A02]
ATGAAATTGATGTTAAAAAAATTGAATGCCGTTAAATTACGAGCCTTTACTCTGATTGAAATGCTAGTCGTACTTCTCAT
TATCAGTATTCTCCTTTTGCTCTTTGTTCCTAACTTAAGCAAGCAGAAGGATTCCGTTAAGGAAACTGGAAATGCGGCTG
TAGTCAAGGTCGTGGATTCTCAGGCAGAACTTTATGAAATGAAGAATAACAAGACAGCTAGCTTGGCAGCTCTTGTTTCA
GAAGGTCAAATTACGCAAAAACAGGCAGATTCATACAATGATTACTATGCGAAACATGGTGGTGAAAGCCGCTCAGTGGC
CAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (14-34)

3D structure

• AlphaFold DB: A0A0E2Q1B3

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYC	Streptococcus mutans UA140	69.231	96.296	0.667
comYC	Streptococcus mutans UA159	69.231	96.296	0.667
comYC	Streptococcus gordonii str. Challis substr. CH1	63.81	97.222	0.62
comGC/cglC	Streptococcus mitis SK321	62.264	98.148	0.611
comGC/cglC	Streptococcus mitis NCTC 12261	58.333	100	0.583
comGC/cglC	Streptococcus pneumoniae D39	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae R6	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae Rx1	58.491	98.148	0.574
comGC/cglC	Streptococcus pneumoniae TIGR4	58.491	98.148	0.574
comGC	Lactococcus lactis subsp. cremoris KW2	56.604	98.148	0.556
comYC	Streptococcus suis isolate S10	60.227	81.481	0.491
comGC	Staphylococcus aureus MW2	50	72.222	0.361
comGC	Staphylococcus aureus N315	50	72.222	0.361