Detailed information NTG0141246

Bioinformatically predicted

Overview

• Name: comYF
• Type: Machinery gene
• Locus tag: MNA02_RS08855
• Genome accession: NZ_CP010999
• Coordinates: 1692560..1692997 (-)
• Length: 145 a.a.
• NCBI ID: WP_011681686.1
• Uniprot ID: -
• Organism: Streptococcus thermophilus strain MN-BM-A02
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1687560..1697997

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
MNA02_RS08815 (MNA02_1810)	-	1687623..1688285 (-)	663	WP_011681679.1	CPBP family intramembrane glutamic endopeptidase	-
MNA02_RS08820	-	1688382..1688825 (-)	444	WP_011681680.1	hypothetical protein	-
MNA02_RS11810 (MNA02_1812)	-	1688899..1689237 (-)	339	WP_224103197.1	CPBP family intramembrane glutamic endopeptidase	-
MNA02_RS11815	-	1689281..1689556 (-)	276	WP_011681681.1	hypothetical protein	-
MNA02_RS08835	-	1689568..1689766 (-)	199	Protein_1676	helix-turn-helix transcriptional regulator	-
MNA02_RS08840 (MNA02_1815)	-	1690015..1691208 (-)	1194	WP_014608740.1	acetate kinase	-
MNA02_RS08845 (MNA02_1816)	comYH	1691264..1692220 (-)	957	WP_011681684.1	class I SAM-dependent methyltransferase	Machinery gene
MNA02_RS08850	comGG	1692265..1692582 (-)	318	WP_011681685.1	competence type IV pilus minor pilin ComGG	-
MNA02_RS08855 (MNA02_1818)	comYF	1692560..1692997 (-)	438	WP_011681686.1	competence type IV pilus minor pilin ComGF	Machinery gene
MNA02_RS08860	comGE	1692981..1693274 (-)	294	WP_024704238.1	competence type IV pilus minor pilin ComGE	-
MNA02_RS08865 (MNA02_1820)	comYD	1693246..1693674 (-)	429	WP_011226626.1	competence type IV pilus minor pilin ComGD	Machinery gene
MNA02_RS08870 (MNA02_1821)	comYC	1693634..1693960 (-)	327	WP_002946126.1	competence type IV pilus major pilin ComGC	Machinery gene
MNA02_RS08875 (MNA02_1822)	comYB	1693957..1695057 (-)	1101	WP_120764773.1	competence type IV pilus assembly protein ComGB	Machinery gene
MNA02_RS08880 (MNA02_1823)	comGA/cglA/cilD	1694939..1695880 (-)	942	WP_022096896.1	competence type IV pilus ATPase ComGA	Machinery gene
MNA02_RS08885 (MNA02_1824)	-	1695961..1696323 (-)	363	WP_014622006.1	DUF1033 family protein	-

Sequence

Protein

• Length: 145 a.a.
• Molecular weight: 16375.85 Da
• Isoelectric Point: 8.4500

>NTDB_id=141246 MNA02_RS08855 WP_011681686.1 1692560..1692997(-) (comYF) [Streptococcus thermophilus strain MN-BM-A02]
MYLSSKLRAFTLLECLVALLVIAGSVQVYQGLTTVLVSNVKQVRQQENQDWLLFVQQMEAELEGCQLVKVEGNKLYVKQD
NQDLAFGLSSASDFRKTNADGRGYQPMLFDVKSSKVSQKNQIVTIQVTLKNELQRSFVYAFEKTG

Nucleotide

• Length: 438 bp

>NTDB_id=141246 MNA02_RS08855 WP_011681686.1 1692560..1692997(-) (comYF) [Streptococcus thermophilus strain MN-BM-A02]
ATGTATCTAAGCAGTAAGCTGCGTGCCTTTACCCTCTTGGAATGTCTAGTGGCCTTGTTGGTCATTGCTGGCTCAGTTCA
AGTTTATCAAGGGTTAACCACTGTACTTGTGAGTAATGTTAAGCAGGTAAGACAACAAGAAAACCAAGATTGGCTTCTAT
TTGTTCAACAAATGGAGGCAGAATTAGAAGGATGTCAGTTGGTCAAGGTAGAGGGGAACAAACTCTATGTCAAGCAGGAT
AATCAAGACTTGGCTTTTGGTCTTTCAAGTGCCTCTGATTTTCGAAAAACAAATGCTGATGGTCGAGGTTATCAACCAAT
GCTTTTCGATGTCAAATCTAGTAAGGTAAGTCAAAAGAACCAGATAGTTACCATCCAAGTGACTCTTAAAAATGAACTAC
AAAGGAGTTTTGTTTATGCTTTTGAAAAAACAGGTTAG

Domains

Predicted by InterproScan.

• Putative Competence protein ComGF (ComGF) (39-134)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYF	Streptococcus mutans UA140	58.156	97.241	0.566
comYF	Streptococcus mutans UA159	57.447	97.241	0.559
comGF/cglF	Streptococcus pneumoniae D39	49.286	96.552	0.476
comGF/cglF	Streptococcus pneumoniae Rx1	49.286	96.552	0.476
comGF/cglF	Streptococcus pneumoniae R6	49.286	96.552	0.476
comGF/cglF	Streptococcus pneumoniae TIGR4	49.286	96.552	0.476
comGF/cglF	Streptococcus mitis NCTC 12261	47.518	97.241	0.462
comGF/cglF	Streptococcus mitis SK321	46.809	97.241	0.455
comGF	Lactococcus lactis subsp. cremoris KW2	45.324	95.862	0.434