Detailed information NTG0134161

Bioinformatically predicted

Overview

• Name: ssbA
• Type: Machinery gene
• Locus tag: BT4G5_RS11965
• Genome accession: NZ_CP010089
• Coordinates: 2279785..2280117 (+)
• Length: 110 a.a.
• NCBI ID: WP_001082769.1
• Uniprot ID: A0A9W5QHQ8
• Organism: Bacillus thuringiensis serovar galleriae strain 4G5
• Function: ssDNA binding (predicted from homology) DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
ICE	2258389..2282011	2279785..2280117	within	0

Gene organization within MGE regions

Location: 2258389..2282011

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
BT4G5_RS11920 (BT4G5_11920)	-	2259450..2262179 (+)	2730	WP_021728047.1	hypothetical protein	-
BT4G5_RS11925 (BT4G5_11925)	-	2262182..2263933 (+)	1752	WP_021729424.1	phage integrase	-
BT4G5_RS11930 (BT4G5_11930)	-	2263926..2264642 (+)	717	WP_021728389.1	hypothetical protein	-
BT4G5_RS11935 (BT4G5_11935)	-	2265403..2269125 (+)	3723	WP_042991544.1	ATP-binding protein	-
BT4G5_RS11940 (BT4G5_11940)	-	2269580..2270947 (-)	1368	WP_021728391.1	hypothetical protein	-
BT4G5_RS11945 (BT4G5_11945)	-	2271125..2271352 (+)	228	WP_021728392.1	helix-turn-helix transcriptional regulator	-
BT4G5_RS11950 (BT4G5_11950)	-	2271745..2271966 (+)	222	WP_021728393.1	hypothetical protein	-
BT4G5_RS11955 (BT4G5_11955)	-	2272720..2272989 (-)	270	Protein_2268	GNAT family N-acetyltransferase	-
BT4G5_RS11960 (BT4G5_11960)	-	2273403..2279405 (+)	6003	WP_021728395.1	ATP-binding protein	-
BT4G5_RS11965 (BT4G5_11965)	ssbA	2279785..2280117 (+)	333	WP_001082769.1	single-stranded DNA-binding protein	Machinery gene
BT4G5_RS11970 (BT4G5_11970)	-	2280454..2281014 (-)	561	WP_000714949.1	AAA family ATPase	-

Sequence

Protein

• Length: 110 a.a.
• Molecular weight: 12610.39 Da
• Isoelectric Point: 9.4344

>NTDB_id=134161 BT4G5_RS11965 WP_001082769.1 2279785..2280117(+) (ssbA) [Bacillus thuringiensis serovar galleriae strain 4G5]
MNRVVLIGRLTKEPELYYTKQGVAYARICVAVNRGFRNSLGEQQVDFINCVVWRKSAENVAEYCKKGSLVGITGRIQTSN
YDDEQGKRIYRTEVVIESITFLERRREGAS

Nucleotide

• Length: 333 bp

>NTDB_id=134161 BT4G5_RS11965 WP_001082769.1 2279785..2280117(+) (ssbA) [Bacillus thuringiensis serovar galleriae strain 4G5]
TTGAATCGAGTTGTATTAATCGGTAGATTGACAAAGGAGCCAGAATTATACTACACAAAACAAGGCGTCGCTTATGCACG
AATATGTGTTGCGGTGAATAGAGGATTTCGAAATAGTTTAGGTGAACAACAAGTCGATTTTATTAATTGTGTCGTTTGGC
GCAAATCGGCTGAGAATGTAGCTGAATATTGTAAGAAGGGGTCGCTCGTTGGGATTACAGGGCGTATTCAGACTAGTAAT
TACGATGATGAACAAGGCAAGAGAATATATAGAACTGAAGTTGTGATTGAGAGTATTACCTTTTTGGAGAGAAGGCGGGA
GGGGGCATCGTAA

Domains

Predicted by InterproScan.

• Single-strand binding protein family (SSB) (1-102)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
ssbA	Bacillus subtilis subsp. subtilis str. 168	59.048	95.455	0.564
ssb	Latilactobacillus sakei subsp. sakei 23K	56.19	95.455	0.536
ssbB	Bacillus subtilis subsp. subtilis str. 168	51.351	100	0.518
ssbB	Lactococcus lactis subsp. cremoris KW2	45.714	95.455	0.436
ssbB	Streptococcus sobrinus strain NIDR 6715-7	43.519	98.182	0.427
ssbA	Streptococcus mutans UA159	40.741	98.182	0.4
ssbB/cilA	Streptococcus mitis NCTC 12261	40.741	98.182	0.4
ssbB/cilA	Streptococcus pneumoniae TIGR4	40.741	98.182	0.4
ssbB/cilA	Streptococcus pneumoniae D39	39.815	98.182	0.391
ssbB/cilA	Streptococcus pneumoniae R6	39.815	98.182	0.391
ssbB/cilA	Streptococcus mitis SK321	39.815	98.182	0.391
ssbB/cilA	Streptococcus pneumoniae Rx1	39.815	98.182	0.391