Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | BWEI_RS13470 | Genome accession | NZ_CP009746 |
| Coordinates | 2692642..2692980 (-) | Length | 112 a.a. |
| NCBI ID | WP_002012564.1 | Uniprot ID | J8I4L2 |
| Organism | Bacillus mycoides strain WSBC10204 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2692642..2710863 | 2692642..2692980 | within | 0 |
Gene organization within MGE regions
Location: 2692642..2710863
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BWEI_RS13470 (bwei_2854) | ssbA | 2692642..2692980 (-) | 339 | WP_002012564.1 | single-stranded DNA-binding protein | Machinery gene |
| BWEI_RS13475 (bwei_2855) | - | 2693142..2693396 (-) | 255 | WP_002012563.1 | DUF4318 domain-containing protein | - |
| BWEI_RS13480 (bwei_2856) | - | 2693491..2694222 (-) | 732 | WP_002127140.1 | Bax inhibitor-1/YccA family protein | - |
| BWEI_RS13485 (bwei_2857) | - | 2694298..2696193 (-) | 1896 | WP_002127139.1 | ABC-F family ATP-binding cassette domain-containing protein | - |
| BWEI_RS13490 (bwei_2858) | - | 2696190..2696837 (-) | 648 | WP_002031647.1 | HD domain-containing protein | - |
| BWEI_RS13495 (bwei_2859) | - | 2696947..2697642 (+) | 696 | WP_002031649.1 | hypothetical protein | - |
| BWEI_RS30635 (bwei_2860) | - | 2698235..2698387 (+) | 153 | WP_002031650.1 | hypothetical protein | - |
| BWEI_RS28585 | - | 2698563..2698705 (+) | 143 | Protein_2792 | DUF3956 family protein | - |
| BWEI_RS13505 (bwei_2861) | - | 2699173..2699688 (-) | 516 | WP_000512143.1 | DUF3231 family protein | - |
| BWEI_RS13510 (bwei_2862) | - | 2700034..2700339 (+) | 306 | WP_002031652.1 | WGxxGxxG family protein | - |
| BWEI_RS13515 (bwei_2863) | - | 2700709..2701251 (-) | 543 | WP_002127134.1 | site-specific integrase | - |
| BWEI_RS13520 (bwei_2864) | - | 2701248..2701718 (-) | 471 | WP_033709027.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| BWEI_RS31165 (bwei_2865) | - | 2701920..2702521 (-) | 602 | Protein_2797 | DUF6944 family repetitive protein | - |
| BWEI_RS13535 | - | 2703956..2704234 (+) | 279 | WP_002127130.1 | hypothetical protein | - |
| BWEI_RS13540 (bwei_2869) | - | 2705095..2705874 (+) | 780 | WP_038626174.1 | BclA C-terminal domain-containing protein | - |
| BWEI_RS13545 | - | 2706386..2707086 (+) | 701 | Protein_2800 | exosporium leader peptide-containing protein | - |
| BWEI_RS13550 (bwei_2872) | - | 2707383..2707847 (+) | 465 | WP_002035352.1 | hypothetical protein | - |
| BWEI_RS13560 (bwei_2875) | - | 2708133..2709275 (+) | 1143 | WP_050426684.1 | exosporium leader peptide-containing protein | - |
| BWEI_RS30640 | - | 2709488..2709706 (+) | 219 | Protein_2803 | hypothetical protein | - |
| BWEI_RS13565 (bwei_2876) | - | 2709727..2710863 (+) | 1137 | WP_002035357.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 112 a.a. Molecular weight: 12966.75 Da Isoelectric Point: 9.1002
>NTDB_id=131785 BWEI_RS13470 WP_002012564.1 2692642..2692980(-) (ssbA) [Bacillus mycoides strain WSBC10204]
MMNRVVLIGRLTKEPELYYTKQGVAYARICVAVNRGFRNSLGEQQVDFINCVVWRRSAENVTEYCTKGSLVGITGRIHTS
NYDDEQGKRVYRTEVLIENITFLERRRESASQ
MMNRVVLIGRLTKEPELYYTKQGVAYARICVAVNRGFRNSLGEQQVDFINCVVWRRSAENVTEYCTKGSLVGITGRIHTS
NYDDEQGKRVYRTEVLIENITFLERRRESASQ
Nucleotide
Download Length: 339 bp
>NTDB_id=131785 BWEI_RS13470 WP_002012564.1 2692642..2692980(-) (ssbA) [Bacillus mycoides strain WSBC10204]
ATGATGAATCGAGTTGTATTAATCGGTAGATTGACAAAGGAGCCAGAATTATACTACACAAAACAAGGTGTCGCTTATGC
ACGAATATGTGTTGCGGTGAATAGAGGTTTTCGAAATAGTTTAGGTGAGCAACAAGTAGATTTTATTAATTGTGTTGTAT
GGAGAAGGTCGGCTGAAAATGTAACAGAATATTGTACGAAAGGCTCACTTGTTGGGATTACAGGGCGTATTCATACGAGT
AATTACGATGATGAACAAGGAAAGAGAGTATATAGAACTGAAGTTCTGATTGAGAATATTACATTTTTAGAGAGAAGGCG
GGAGAGTGCATCGCAATAA
ATGATGAATCGAGTTGTATTAATCGGTAGATTGACAAAGGAGCCAGAATTATACTACACAAAACAAGGTGTCGCTTATGC
ACGAATATGTGTTGCGGTGAATAGAGGTTTTCGAAATAGTTTAGGTGAGCAACAAGTAGATTTTATTAATTGTGTTGTAT
GGAGAAGGTCGGCTGAAAATGTAACAGAATATTGTACGAAAGGCTCACTTGTTGGGATTACAGGGCGTATTCATACGAGT
AATTACGATGATGAACAAGGAAAGAGAGTATATAGAACTGAAGTTCTGATTGAGAATATTACATTTTTAGAGAGAAGGCG
GGAGAGTGCATCGCAATAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
57.547 |
94.643 |
0.545 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
53.774 |
94.643 |
0.509 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
50.442 |
100 |
0.509 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
43.86 |
100 |
0.446 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
42.727 |
98.214 |
0.42 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
42.727 |
98.214 |
0.42 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
41.818 |
98.214 |
0.411 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
41.818 |
98.214 |
0.411 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
41.818 |
98.214 |
0.411 |
| ssbB/cilA | Streptococcus mitis SK321 |
41.818 |
98.214 |
0.411 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40.909 |
98.214 |
0.402 |
| ssbA | Streptococcus mutans UA159 |
40.909 |
98.214 |
0.402 |