Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | DP15_RS02305 | Genome accession | NZ_CP008926 |
| Coordinates | 459794..460186 (-) | Length | 130 a.a. |
| NCBI ID | WP_011017370.1 | Uniprot ID | - |
| Organism | Streptococcus pyogenes strain ATCC 19615 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 430181..480794 | 459794..460186 | within | 0 |
Gene organization within MGE regions
Location: 430181..480794
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DP15_RS02120 (DP15_432) | recU | 430181..430789 (+) | 609 | WP_002983622.1 | Holliday junction resolvase RecU | - |
| DP15_RS02125 (DP15_433) | pbp1a | 430776..432941 (+) | 2166 | WP_023609908.1 | penicillin-binding protein PBP1A | - |
| DP15_RS02130 (DP15_435) | prx | 433185..433367 (-) | 183 | WP_011017399.1 | hypothetical protein | Regulator |
| DP15_RS02135 (DP15_436) | speA | 433587..434342 (+) | 756 | WP_009880239.1 | streptococcal pyrogenic exotoxin SpeA | - |
| DP15_RS02140 (DP15_437) | - | 434464..435681 (-) | 1218 | WP_023611377.1 | peptidoglycan amidohydrolase family protein | - |
| DP15_RS02150 (DP15_439) | - | 435800..436027 (-) | 228 | WP_003058873.1 | phage holin | - |
| DP15_RS02155 (DP15_440) | - | 436024..436296 (-) | 273 | WP_011017397.1 | hypothetical protein | - |
| DP15_RS02160 (DP15_441) | - | 436308..436940 (-) | 633 | WP_023611372.1 | hypothetical protein | - |
| DP15_RS02165 (DP15_442) | - | 436943..437371 (-) | 429 | WP_002988448.1 | DUF1617 family protein | - |
| DP15_RS02170 (DP15_443) | - | 437383..439287 (-) | 1905 | WP_011017395.1 | gp58-like family protein | - |
| DP15_RS02175 (DP15_444) | - | 439297..440303 (-) | 1007 | Protein_422 | hyaluronoglucosaminidase | - |
| DP15_RS02180 (DP15_446) | - | 440300..442351 (-) | 2052 | WP_038432431.1 | phage tail spike protein | - |
| DP15_RS02185 (DP15_447) | - | 442348..443118 (-) | 771 | WP_011017392.1 | distal tail protein Dit | - |
| DP15_RS02190 (DP15_448) | - | 443131..447231 (-) | 4101 | WP_023611657.1 | phage tail tape measure protein | - |
| DP15_RS02200 (DP15_449) | gpG | 447457..447759 (-) | 303 | WP_011017390.1 | phage tail assembly chaperone G | - |
| DP15_RS02205 (DP15_450) | - | 447852..448436 (-) | 585 | WP_011017389.1 | major tail protein | - |
| DP15_RS02210 (DP15_451) | - | 448448..448828 (-) | 381 | WP_011017388.1 | hypothetical protein | - |
| DP15_RS02215 (DP15_452) | - | 448821..449219 (-) | 399 | WP_011017387.1 | HK97 gp10 family phage protein | - |
| DP15_RS02220 (DP15_453) | - | 449221..449583 (-) | 363 | WP_011017386.1 | hypothetical protein | - |
| DP15_RS02225 (DP15_454) | - | 449576..449884 (-) | 309 | WP_011017385.1 | hypothetical protein | - |
| DP15_RS09935 (DP15_455) | - | 449884..450057 (-) | 174 | WP_011017384.1 | hypothetical protein | - |
| DP15_RS02230 (DP15_456) | - | 450071..451204 (-) | 1134 | WP_011017383.1 | phage major capsid protein | - |
| DP15_RS02235 (DP15_457) | - | 451221..452027 (-) | 807 | WP_023611660.1 | head maturation protease, ClpP-related | - |
| DP15_RS02240 (DP15_458) | - | 452008..453195 (-) | 1188 | WP_011017381.1 | phage portal protein | - |
| DP15_RS02245 (DP15_459) | - | 453348..453560 (-) | 213 | WP_225793055.1 | hypothetical protein | - |
| DP15_RS02250 (DP15_460) | - | 453563..455293 (-) | 1731 | WP_011017380.1 | terminase large subunit domain-containing protein | - |
| DP15_RS02255 (DP15_461) | - | 455306..455623 (-) | 318 | WP_011017379.1 | P27 family phage terminase small subunit | - |
| DP15_RS02260 (DP15_462) | - | 455764..456069 (-) | 306 | WP_011017378.1 | HNH endonuclease | - |
| DP15_RS02265 (DP15_463) | - | 456062..456448 (-) | 387 | WP_011017377.1 | hypothetical protein | - |
| DP15_RS02270 (DP15_464) | - | 456474..456677 (-) | 204 | WP_011017376.1 | hypothetical protein | - |
| DP15_RS02275 (DP15_465) | - | 456735..457028 (-) | 294 | WP_011017375.1 | hypothetical protein | - |
| DP15_RS02280 (DP15_466) | - | 457182..457757 (-) | 576 | WP_011054435.1 | site-specific integrase | - |
| DP15_RS02285 (DP15_467) | - | 457917..458318 (-) | 402 | WP_011017373.1 | hypothetical protein | - |
| DP15_RS02290 (DP15_468) | - | 458333..459160 (-) | 828 | WP_011017372.1 | prohibitin family protein | - |
| DP15_RS02295 (DP15_469) | - | 459163..459501 (-) | 339 | WP_011017371.1 | helix-turn-helix domain-containing protein | - |
| DP15_RS02300 (DP15_470) | - | 459498..459779 (-) | 282 | WP_011054431.1 | hypothetical protein | - |
| DP15_RS02305 (DP15_471) | ssbA | 459794..460186 (-) | 393 | WP_011017370.1 | single-stranded DNA-binding protein | Machinery gene |
| DP15_RS02310 (DP15_472) | - | 460183..460404 (-) | 222 | WP_011017369.1 | hypothetical protein | - |
| DP15_RS02315 (DP15_473) | - | 460401..460886 (-) | 486 | WP_011017368.1 | DUF1642 domain-containing protein | - |
| DP15_RS02320 (DP15_474) | - | 460891..461523 (-) | 633 | WP_023611652.1 | N-6 DNA methylase | - |
| DP15_RS02325 (DP15_475) | - | 461525..461794 (-) | 270 | WP_011017366.1 | hypothetical protein | - |
| DP15_RS09940 (DP15_476) | - | 461791..461961 (-) | 171 | WP_023611649.1 | hypothetical protein | - |
| DP15_RS02330 (DP15_477) | - | 461958..462401 (-) | 444 | WP_011017365.1 | YopX family protein | - |
| DP15_RS10175 (DP15_478) | - | 462418..462543 (-) | 126 | WP_257000584.1 | hypothetical protein | - |
| DP15_RS02335 (DP15_479) | - | 462557..462784 (-) | 228 | WP_032467212.1 | hypothetical protein | - |
| DP15_RS02340 (DP15_480) | - | 462784..463596 (-) | 813 | WP_023611651.1 | ATP-binding protein | - |
| DP15_RS02345 (DP15_481) | - | 463596..464357 (-) | 762 | WP_011017361.1 | conserved phage C-terminal domain-containing protein | - |
| DP15_RS02350 (DP15_482) | dnaB | 464350..465690 (-) | 1341 | WP_011017360.1 | replicative DNA helicase | - |
| DP15_RS02355 (DP15_483) | - | 465677..465865 (-) | 189 | WP_032461348.1 | hypothetical protein | - |
| DP15_RS02360 (DP15_484) | - | 465986..466177 (-) | 192 | WP_038432436.1 | hypothetical protein | - |
| DP15_RS02365 (DP15_485) | - | 466270..466527 (-) | 258 | WP_011054421.1 | hypothetical protein | - |
| DP15_RS02370 (DP15_486) | - | 466601..467320 (-) | 720 | WP_011017357.1 | ORF6C domain-containing protein | - |
| DP15_RS02375 (DP15_487) | - | 467372..467872 (+) | 501 | WP_032464978.1 | hypothetical protein | - |
| DP15_RS10180 (DP15_488) | - | 467992..468126 (-) | 135 | WP_011017356.1 | hypothetical protein | - |
| DP15_RS02380 (DP15_489) | - | 468200..468412 (-) | 213 | WP_011054420.1 | helix-turn-helix domain-containing protein | - |
| DP15_RS02385 (DP15_490) | - | 468447..468722 (-) | 276 | WP_011017354.1 | hypothetical protein | - |
| DP15_RS02390 (DP15_491) | - | 469011..469361 (+) | 351 | WP_011017353.1 | helix-turn-helix domain-containing protein | - |
| DP15_RS02395 (DP15_492) | - | 469365..469757 (+) | 393 | WP_011017352.1 | ImmA/IrrE family metallo-endopeptidase | - |
| DP15_RS02400 (DP15_493) | - | 469768..470508 (+) | 741 | WP_011017351.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| DP15_RS02405 (DP15_494) | - | 470819..472015 (+) | 1197 | WP_011017350.1 | site-specific integrase | - |
| DP15_RS02410 (DP15_495) | pepC | 472418..473755 (-) | 1338 | WP_002983616.1 | aminopeptidase C | - |
| DP15_RS02415 (DP15_496) | nadE | 473940..474764 (-) | 825 | WP_003055492.1 | ammonia-dependent NAD(+) synthetase | - |
| DP15_RS02420 (DP15_497) | - | 474766..476220 (-) | 1455 | WP_038432439.1 | nicotinate phosphoribosyltransferase | - |
| DP15_RS02425 (DP15_498) | - | 476391..477770 (-) | 1380 | WP_002988920.1 | amino acid permease | - |
| DP15_RS02430 (DP15_499) | trxB | 477939..478856 (-) | 918 | WP_023079248.1 | thioredoxin-disulfide reductase | - |
| DP15_RS02435 (DP15_500) | - | 478920..479144 (-) | 225 | WP_002988906.1 | DUF4059 family protein | - |
| DP15_RS02440 (DP15_501) | - | 479248..479991 (-) | 744 | WP_002983603.1 | amino acid ABC transporter ATP-binding protein | - |
| DP15_RS02445 (DP15_502) | - | 479991..480794 (-) | 804 | WP_002988904.1 | amino acid ABC transporter permease | - |
Sequence
Protein
Download Length: 130 a.a. Molecular weight: 14755.61 Da Isoelectric Point: 6.3209
>NTDB_id=125771 DP15_RS02305 WP_011017370.1 459794..460186(-) (ssbA) [Streptococcus pyogenes strain ATCC 19615]
MINNVVLIGRLTKDVELRYTPSQVACAQFTLAVNRNFKNQDGQKEADFINCVIWRKSAENLSNWAKKGQLIAITGRIQTR
NYENQQGQRVYVTEVVAESFQILEKRDNTANTSSLADSMPDYGPEPDLPF
MINNVVLIGRLTKDVELRYTPSQVACAQFTLAVNRNFKNQDGQKEADFINCVIWRKSAENLSNWAKKGQLIAITGRIQTR
NYENQQGQRVYVTEVVAESFQILEKRDNTANTSSLADSMPDYGPEPDLPF
Nucleotide
Download Length: 393 bp
>NTDB_id=125771 DP15_RS02305 WP_011017370.1 459794..460186(-) (ssbA) [Streptococcus pyogenes strain ATCC 19615]
ATGATCAATAACGTTGTTTTGATTGGCCGCTTAACAAAAGATGTTGAGCTACGCTATACACCAAGTCAAGTAGCTTGCGC
ACAGTTTACTTTAGCAGTTAATCGTAATTTTAAAAATCAAGATGGGCAAAAAGAGGCTGACTTTATCAATTGTGTCATCT
GGCGAAAGTCTGCCGAGAATTTATCAAACTGGGCTAAAAAAGGGCAATTGATTGCAATAACAGGACGCATACAGACTCGT
AATTATGAAAACCAGCAAGGACAACGTGTCTATGTTACGGAAGTTGTCGCAGAAAGCTTCCAGATTTTGGAGAAGCGTGA
TAACACTGCAAACACAAGCAGTTTAGCTGATAGCATGCCAGACTATGGACCAGAACCAGATTTACCATTTTAG
ATGATCAATAACGTTGTTTTGATTGGCCGCTTAACAAAAGATGTTGAGCTACGCTATACACCAAGTCAAGTAGCTTGCGC
ACAGTTTACTTTAGCAGTTAATCGTAATTTTAAAAATCAAGATGGGCAAAAAGAGGCTGACTTTATCAATTGTGTCATCT
GGCGAAAGTCTGCCGAGAATTTATCAAACTGGGCTAAAAAAGGGCAATTGATTGCAATAACAGGACGCATACAGACTCGT
AATTATGAAAACCAGCAAGGACAACGTGTCTATGTTACGGAAGTTGTCGCAGAAAGCTTCCAGATTTTGGAGAAGCGTGA
TAACACTGCAAACACAAGCAGTTTAGCTGATAGCATGCCAGACTATGGACCAGAACCAGATTTACCATTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
68.224 |
82.308 |
0.562 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
66.972 |
83.846 |
0.562 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
48.148 |
100 |
0.5 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
44.853 |
100 |
0.469 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
44.853 |
100 |
0.469 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
44.118 |
100 |
0.462 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
44.118 |
100 |
0.462 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
44.118 |
100 |
0.462 |
| ssbB/cilA | Streptococcus mitis SK321 |
43.704 |
100 |
0.454 |
| ssbA | Streptococcus mutans UA159 |
43.704 |
100 |
0.454 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
53.774 |
81.538 |
0.438 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
42.636 |
99.231 |
0.423 |