Detailed information
Bioinformatically predicted
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | DR75_RS05430 | Genome accession | NZ_CP008816 |
| Coordinates | 961708..961983 (-) | Length | 91 a.a. |
| NCBI ID | WP_002364235.1 | Uniprot ID | - |
| Organism | Enterococcus faecalis ATCC 29212 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 956708..966983
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DR75_RS05385 (DR75_940) | - | 956807..957085 (+) | 279 | WP_002380425.1 | hypothetical protein | - |
| DR75_RS05395 (DR75_941) | - | 957263..957736 (+) | 474 | WP_002357065.1 | universal stress protein | - |
| DR75_RS05400 (DR75_942) | - | 957848..959035 (-) | 1188 | WP_002357064.1 | acetate/propionate family kinase | - |
| DR75_RS05405 (DR75_943) | - | 959060..960067 (-) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| DR75_RS05410 (DR75_944) | comGG | 960196..960549 (-) | 354 | WP_002360027.1 | competence type IV pilus minor pilin ComGG | - |
| DR75_RS05415 (DR75_945) | comGF | 960549..960983 (-) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| DR75_RS05420 (DR75_946) | - | 960973..961299 (-) | 327 | WP_010784600.1 | type II secretion system protein | - |
| DR75_RS05425 (DR75_947) | comGD | 961265..961711 (-) | 447 | WP_002366895.1 | competence type IV pilus minor pilin ComGD | - |
| DR75_RS05430 (DR75_948) | comGC/cglC | 961708..961983 (-) | 276 | WP_002364235.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| DR75_RS05435 (DR75_949) | comGB | 961983..963029 (-) | 1047 | WP_002364236.1 | competence type IV pilus assembly protein ComGB | - |
| DR75_RS05440 (DR75_950) | comGA | 962986..963954 (-) | 969 | WP_002364237.1 | competence type IV pilus ATPase ComGA | - |
| DR75_RS05445 (DR75_951) | - | 964195..965523 (-) | 1329 | WP_010784613.1 | APC family permease | - |
| DR75_RS05450 (DR75_952) | rlmN | 965813..966886 (-) | 1074 | WP_002364241.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10506.50 Da Isoelectric Point: 9.6586
>NTDB_id=124456 DR75_RS05430 WP_002364235.1 961708..961983(-) (comGC/cglC) [Enterococcus faecalis ATCC 29212]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNRTPSLNELVKEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNRTPSLNELVKEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=124456 DR75_RS05430 WP_002364235.1 961708..961983(-) (comGC/cglC) [Enterococcus faecalis ATCC 29212]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATCATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAGGACGCCTTCTTTAAATGAATTAGTCAAAGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATCATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAGGACGCCTTCTTTAAATGAATTAGTCAAAGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
48.101 |
86.813 |
0.418 |
| comGC | Staphylococcus aureus N315 |
48.101 |
86.813 |
0.418 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |