Detailed information NTG1170022

Bioinformatically predicted

Overview

• Name: ssbB/cilA
• Type: Machinery gene
• Locus tag: ACLV7Q_RS01675
• Genome accession: NZ_OZ217341
• Coordinates: 325990..326385 (+)
• Length: 131 a.a.
• NCBI ID: WP_173307402.1
• Uniprot ID: -
• Organism: Streptococcus mitis isolate S. mitis C22
• Function: ssDNA binding (predicted from homology) DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
IS/Tn	324532..325824	325990..326385	flank	166

Gene organization within MGE regions

Location: 324532..326385

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACLV7Q_RS01670 (SMIC22_03170)	-	324532..325788 (-)	1257	WP_173306895.1	ISL3 family transposase	-
ACLV7Q_RS01675 (SMIC22_03180)	ssbB/cilA	325990..326385 (+)	396	WP_173307402.1	single-stranded DNA-binding protein	Machinery gene

Sequence

Protein

• Length: 131 a.a.
• Molecular weight: 14923.85 Da
• Isoelectric Point: 5.9409

>NTDB_id=1170022 ACLV7Q_RS01675 WP_173307402.1 325990..326385(+) (ssbB/cilA) [Streptococcus mitis isolate S. mitis C22]
MYNKVILIGRLTSTPELHKTNNDKSVARATIAVNRRYKDQNGEREADFVNMVLWGRLAETLASYATKGSLISVDGELRTR
RFEKNGQMNYVTEVLVTGFQLLESRAQRAMRENNAGQDLSDLVLEEEELPF

Nucleotide

• Length: 396 bp

>NTDB_id=1170022 ACLV7Q_RS01675 WP_173307402.1 325990..326385(+) (ssbB/cilA) [Streptococcus mitis isolate S. mitis C22]
ATGTATAATAAAGTTATTTTAATCGGACGCTTGACGTCTACACCAGAATTGCACAAAACCAACAATGACAAGTCAGTAGC
GCGAGCAACTATCGCTGTAAATCGTCGTTACAAAGACCAAAACGGGGAACGCGAAGCTGATTTTGTCAATATGGTCCTAT
GGGGCAGACTAGCAGAAACTTTGGCAAGCTACGCAACCAAAGGTAGTCTTATTTCCGTTGATGGGGAATTGCGTACCCGT
CGTTTTGAGAAAAATGGTCAAATGAATTATGTGACCGAAGTACTTGTCACAGGATTCCAACTCTTGGAAAGTCGTGCCCA
ACGTGCTATGCGAGAAAATAATGCAGGTCAAGATTTGTCGGATTTGGTTTTGGAAGAGGAGGAATTGCCATTTTAA

Domains

Predicted by InterproScan.

• Single-strand binding protein family (SSB) (3-101)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
ssbB/cilA	Streptococcus pneumoniae TIGR4	99.237	100	0.992
ssbB/cilA	Streptococcus pneumoniae Rx1	98.473	100	0.985
ssbB/cilA	Streptococcus pneumoniae D39	98.473	100	0.985
ssbB/cilA	Streptococcus pneumoniae R6	98.473	100	0.985
ssbB/cilA	Streptococcus mitis SK321	98.473	100	0.985
ssbB/cilA	Streptococcus mitis NCTC 12261	96.947	100	0.969
ssbA	Streptococcus mutans UA159	74.809	100	0.748
ssbB	Streptococcus sobrinus strain NIDR 6715-7	70.992	100	0.71
ssbB	Lactococcus lactis subsp. cremoris KW2	60.714	85.496	0.519
ssbA	Bacillus subtilis subsp. subtilis str. 168	51.887	80.916	0.42
ssb	Latilactobacillus sakei subsp. sakei 23K	47.788	86.26	0.412
ssbB	Bacillus subtilis subsp. subtilis str. 168	44.444	82.443	0.366