Detailed information NTG1169469

Bioinformatically predicted

Overview

• Name: comGC/cglC
• Type: Machinery gene
• Locus tag: ACNUD9_RS02730
• Genome accession: NZ_OZ197096
• Coordinates: 605923..606198 (+)
• Length: 91 a.a.
• NCBI ID: WP_002356991.1
• Uniprot ID: A0A1B4XPV0
• Organism: Enterococcus faecalis isolate 23S00039-2
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 600923..611198

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACNUD9_RS02710	rlmN	601020..602093 (+)	1074	WP_002356987.1	23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN	-
ACNUD9_RS02715	-	602383..603711 (+)	1329	WP_002362058.1	APC family permease	-
ACNUD9_RS02720	comGA	603952..604920 (+)	969	Protein_534	competence type IV pilus ATPase ComGA	-
ACNUD9_RS02725	comGB	604877..605923 (+)	1047	WP_002356990.1	competence type IV pilus assembly protein ComGB	-
ACNUD9_RS02730	comGC/cglC	605923..606198 (+)	276	WP_002356991.1	competence type IV pilus major pilin ComGC	Machinery gene
ACNUD9_RS02735	comGD	606195..606641 (+)	447	WP_002379576.1	competence type IV pilus minor pilin ComGD	-
ACNUD9_RS02740	-	606607..606933 (+)	327	WP_010775953.1	type II secretion system protein	-
ACNUD9_RS02745	comGF	606923..607357 (+)	435	WP_002357060.1	competence type IV pilus minor pilin ComGF	-
ACNUD9_RS02750	comGG	607357..607710 (+)	354	WP_002362054.1	competence type IV pilus minor pilin ComGG	-
ACNUD9_RS02755	-	607839..608846 (+)	1008	WP_002357063.1	class I SAM-dependent methyltransferase	-
ACNUD9_RS02760	-	608871..610058 (+)	1188	WP_002357064.1	acetate/propionate family kinase	-
ACNUD9_RS02765	-	610170..610643 (-)	474	WP_002357065.1	universal stress protein	-

Sequence

Protein

• Length: 91 a.a.
• Molecular weight: 10464.41 Da
• Isoelectric Point: 9.3192

>NTDB_id=1169469 ACNUD9_RS02730 WP_002356991.1 605923..606198(+) (comGC/cglC) [Enterococcus faecalis isolate 23S00039-2]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ

Nucleotide

• Length: 276 bp

>NTDB_id=1169469 ACNUD9_RS02730 WP_002356991.1 605923..606198(+) (comGC/cglC) [Enterococcus faecalis isolate 23S00039-2]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (5-28)

3D structure

• AlphaFold DB: A0A1B4XPV0

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC/cglC	Streptococcus pneumoniae Rx1	63.095	92.308	0.582
comGC/cglC	Streptococcus pneumoniae D39	63.095	92.308	0.582
comGC/cglC	Streptococcus pneumoniae R6	63.095	92.308	0.582
comGC/cglC	Streptococcus pneumoniae TIGR4	63.095	92.308	0.582
comGC/cglC	Streptococcus mitis NCTC 12261	61.905	92.308	0.571
comGC/cglC	Streptococcus mitis SK321	61.176	93.407	0.571
comGC	Lactococcus lactis subsp. cremoris KW2	58.14	94.505	0.549
comYC	Streptococcus gordonii str. Challis substr. CH1	56.322	95.604	0.538
comYC	Streptococcus suis isolate S10	52.326	94.505	0.495
comYC	Streptococcus mutans UA159	57.692	85.714	0.495
comYC	Streptococcus mutans UA140	57.692	85.714	0.495
comGC	Latilactobacillus sakei subsp. sakei 23K	46.154	100	0.462
comGC	Staphylococcus aureus MW2	46.835	86.813	0.407
comGC	Staphylococcus aureus N315	46.835	86.813	0.407
comGC	Bacillus subtilis subsp. subtilis str. 168	48.649	81.319	0.396