Detailed information NTG1151898

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: MD993_RS07120
• Genome accession: NZ_OV648025
• Coordinates: 1541876..1542187 (-)
• Length: 103 a.a.
• NCBI ID: WP_000921699.1
• Uniprot ID: A0A7U7JUV8
• Organism: Staphylococcus argenteus isolate 20S00001-1_long
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1536876..1547187

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
MD993_RS07085	gcvPA	1537379..1538725 (-)	1347	WP_031787255.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
MD993_RS07090	gcvT	1538744..1539835 (-)	1092	WP_000093342.1	glycine cleavage system aminomethyltransferase GcvT	-
MD993_RS07095	-	1539992..1540516 (-)	525	WP_031787256.1	shikimate kinase	-
MD993_RS07100	-	1540503..1540652 (-)	150	WP_072324192.1	hypothetical protein	-
MD993_RS07105	comGF	1540751..1541248 (-)	498	WP_072324133.1	competence type IV pilus minor pilin ComGF	Machinery gene
MD993_RS07110	comGE	1541166..1541465 (-)	300	WP_031787259.1	hypothetical protein	Machinery gene
MD993_RS07115	comGD	1541452..1541898 (-)	447	WP_072324131.1	competence type IV pilus minor pilin ComGD	Machinery gene
MD993_RS07120	comGC	1541876..1542187 (-)	312	WP_000921699.1	competence type IV pilus major pilin ComGC	Machinery gene
MD993_RS07125	comGB	1542202..1543272 (-)	1071	WP_031787261.1	competence type IV pilus assembly protein ComGB	Machinery gene
MD993_RS07130	comGA	1543244..1544218 (-)	975	WP_031787262.1	competence type IV pilus ATPase ComGA	Machinery gene
MD993_RS07135	-	1544270..1544893 (-)	624	WP_031787263.1	MBL fold metallo-hydrolase	-
MD993_RS07140	-	1544890..1545219 (-)	330	WP_001018874.1	MTH1187 family thiamine-binding protein	-
MD993_RS07145	-	1545219..1546205 (-)	987	WP_000161316.1	ROK family glucokinase	-
MD993_RS07150	-	1546205..1546405 (-)	201	WP_000087563.1	YqgQ family protein	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11189.29 Da
• Isoelectric Point: 9.1992

>NTDB_id=1151898 MD993_RS07120 WP_000921699.1 1541876..1542187(-) (comGC) [Staphylococcus argenteus isolate 20S00001-1_long]
MLKVIKKAKAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIDELVADGFI
KEAQKTCKSGETISISNGEAIAN

Nucleotide

• Length: 312 bp

>NTDB_id=1151898 MD993_RS07120 WP_000921699.1 1541876..1542187(-) (comGC) [Staphylococcus argenteus isolate 20S00001-1_long]
ATGTTGAAAGTTATTAAAAAAGCTAAAGCATTTACTTTAATAGAAATGCTATTAGTTCTATTAATTATAAGCTTATTATT
AATTTTAATTATTCCAAATATCGCGAAACAAACAGCGCATATCCAATCTACTGGATGTAATGCACAAGTTAAAATGGTTA
ATAGTCAAATTGAAGCTTATGCATTGAAACACAATAGAAATCCTTCTTCAATTGATGAACTAGTAGCTGATGGCTTTATT
AAAGAGGCACAAAAAACATGTAAATCTGGTGAAACAATATCGATTAGTAATGGAGAAGCTATTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

3D structure

• AlphaFold DB: A0A7U7JUV8

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	90.291	100	0.903
comGC	Staphylococcus aureus N315	90.291	100	0.903
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	43.878	95.146	0.417
comYC	Streptococcus mutans UA159	48.235	82.524	0.398
comYC	Streptococcus mutans UA140	48.235	82.524	0.398
comYC	Streptococcus suis isolate S10	51.282	75.728	0.388
comGC	Lactococcus lactis subsp. cremoris KW2	48.78	79.612	0.388
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369