Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | KG893_RS08840 | Genome accession | NZ_OD940440 |
| Coordinates | 1780080..1780355 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis isolate WE0254 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1740138..1798462 | 1780080..1780355 | within | 0 |
Gene organization within MGE regions
Location: 1740138..1798462
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KG893_RS08570 (WE0254_01751) | - | 1740138..1741145 (-) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| KG893_RS08575 (WE0254_01752) | comGG | 1741274..1741627 (-) | 354 | WP_002381743.1 | competence type IV pilus minor pilin ComGG | - |
| KG893_RS08580 (WE0254_01753) | comGF | 1741627..1742060 (-) | 434 | Protein_1672 | competence type IV pilus minor pilin ComGF | - |
| KG893_RS08585 (WE0254_01754) | - | 1742050..1742421 (-) | 372 | WP_002365830.1 | type II secretion system protein | - |
| KG893_RS14885 (WE0254_01755) | - | 1742755..1742880 (+) | 126 | WP_002364184.1 | hypothetical protein | - |
| KG893_RS08590 (WE0254_01756) | hemH | 1743177..1744118 (-) | 942 | WP_002365831.1 | ferrochelatase | - |
| KG893_RS08600 (WE0254_01758) | - | 1744861..1745112 (-) | 252 | WP_002365832.1 | hypothetical protein | - |
| KG893_RS08605 (WE0254_01759) | - | 1745184..1745384 (-) | 201 | WP_002357053.1 | cold-shock protein | - |
| KG893_RS08610 (WE0254_01760) | - | 1746221..1747480 (-) | 1260 | WP_010730811.1 | LysM peptidoglycan-binding domain-containing protein | - |
| KG893_RS08615 (WE0254_01761) | - | 1747493..1747873 (-) | 381 | WP_002378446.1 | phage holin family protein | - |
| KG893_RS08620 (WE0254_01762) | - | 1747884..1748006 (-) | 123 | WP_010730812.1 | XkdX family protein | - |
| KG893_RS08625 (WE0254_01763) | - | 1748008..1748403 (-) | 396 | WP_002363385.1 | hypothetical protein | - |
| KG893_RS08630 (WE0254_01764) | - | 1748422..1748874 (-) | 453 | WP_002363384.1 | hypothetical protein | - |
| KG893_RS08635 (WE0254_01765) | - | 1748891..1749631 (-) | 741 | WP_002363383.1 | hypothetical protein | - |
| KG893_RS08640 (WE0254_01766) | - | 1749637..1751082 (-) | 1446 | WP_010730813.1 | phage tail spike protein | - |
| KG893_RS08645 (WE0254_01767) | - | 1751082..1751804 (-) | 723 | WP_010730814.1 | hypothetical protein | - |
| KG893_RS08650 (WE0254_01768) | - | 1751801..1756255 (-) | 4455 | WP_202256197.1 | phage tail tape measure protein | - |
| KG893_RS08655 (WE0254_01769) | - | 1756242..1756547 (-) | 306 | WP_002366371.1 | hypothetical protein | - |
| KG893_RS08660 (WE0254_01770) | - | 1756616..1757014 (-) | 399 | WP_010730816.1 | tail assembly chaperone | - |
| KG893_RS08665 (WE0254_01771) | - | 1757077..1757385 (-) | 309 | WP_010730817.1 | hypothetical protein | - |
| KG893_RS08670 (WE0254_01772) | - | 1757388..1757993 (-) | 606 | WP_002364302.1 | phage major tail protein, TP901-1 family | - |
| KG893_RS08675 (WE0254_01773) | - | 1758012..1758404 (-) | 393 | WP_010730818.1 | hypothetical protein | - |
| KG893_RS08680 (WE0254_01774) | - | 1758401..1758739 (-) | 339 | WP_010730819.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| KG893_RS08685 (WE0254_01775) | - | 1758736..1759011 (-) | 276 | WP_010730820.1 | hypothetical protein | - |
| KG893_RS08690 (WE0254_01776) | - | 1759008..1759340 (-) | 333 | WP_002363369.1 | phage head-tail connector protein | - |
| KG893_RS08695 (WE0254_01777) | - | 1759411..1760307 (-) | 897 | WP_010730821.1 | hypothetical protein | - |
| KG893_RS08700 (WE0254_01778) | - | 1760320..1760955 (-) | 636 | WP_010730822.1 | DUF4355 domain-containing protein | - |
| KG893_RS08705 (WE0254_01779) | - | 1761078..1762004 (-) | 927 | WP_002364298.1 | minor capsid protein | - |
| KG893_RS08710 (WE0254_01780) | - | 1761997..1763481 (-) | 1485 | WP_010730823.1 | phage portal protein | - |
| KG893_RS08715 (WE0254_01781) | - | 1763481..1764764 (-) | 1284 | WP_002369892.1 | PBSX family phage terminase large subunit | - |
| KG893_RS08720 (WE0254_01782) | - | 1764745..1765179 (-) | 435 | WP_002364295.1 | terminase small subunit | - |
| KG893_RS14890 | - | 1765211..1765441 (-) | 231 | Protein_1701 | hypothetical protein | - |
| KG893_RS08725 (WE0254_01783) | - | 1765998..1766576 (-) | 579 | WP_002392366.1 | hypothetical protein | - |
| KG893_RS08730 (WE0254_01784) | - | 1766548..1767417 (-) | 870 | WP_033626200.1 | hypothetical protein | - |
| KG893_RS08740 (WE0254_01786) | - | 1768153..1768569 (-) | 417 | WP_002357018.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| KG893_RS08745 | - | 1769477..1769885 (-) | 409 | Protein_1705 | RusA family crossover junction endodeoxyribonuclease | - |
| KG893_RS08750 (WE0254_01789) | - | 1769882..1770739 (-) | 858 | WP_002392361.1 | helix-turn-helix domain-containing protein | - |
| KG893_RS08755 (WE0254_01790) | - | 1770732..1770938 (-) | 207 | WP_227660692.1 | hypothetical protein | - |
| KG893_RS08760 (WE0254_01791) | - | 1770943..1771584 (-) | 642 | WP_002364344.1 | putative HNHc nuclease | - |
| KG893_RS08765 (WE0254_01792) | - | 1771589..1772323 (-) | 735 | WP_002364345.1 | ERF family protein | - |
| KG893_RS08770 (WE0254_01793) | - | 1772316..1772633 (-) | 318 | WP_002357007.1 | hypothetical protein | - |
| KG893_RS08775 (WE0254_01794) | - | 1772853..1773407 (+) | 555 | WP_002357006.1 | hypothetical protein | - |
| KG893_RS08780 (WE0254_01796) | - | 1773692..1774030 (-) | 339 | WP_002357003.1 | hypothetical protein | - |
| KG893_RS08785 (WE0254_01797) | - | 1774067..1774276 (-) | 210 | WP_002357002.1 | hypothetical protein | - |
| KG893_RS08790 | - | 1774331..1774519 (+) | 189 | WP_002357001.1 | YegP family protein | - |
| KG893_RS08795 (WE0254_01798) | - | 1774545..1775270 (-) | 726 | WP_010730824.1 | ORF6C domain-containing protein | - |
| KG893_RS08800 (WE0254_01799) | - | 1775309..1775620 (-) | 312 | WP_002381719.1 | hypothetical protein | - |
| KG893_RS15040 | - | 1775632..1775799 (-) | 168 | WP_002388204.1 | hypothetical protein | - |
| KG893_RS08805 (WE0254_01801) | - | 1776217..1776414 (-) | 198 | WP_010712611.1 | hypothetical protein | - |
| KG893_RS08810 (WE0254_01802) | - | 1776427..1776609 (-) | 183 | WP_002358110.1 | hypothetical protein | - |
| KG893_RS08815 (WE0254_01803) | - | 1776906..1777238 (+) | 333 | WP_002392358.1 | helix-turn-helix domain-containing protein | - |
| KG893_RS08820 (WE0254_01804) | - | 1777256..1777600 (+) | 345 | WP_002378467.1 | ImmA/IrrE family metallo-endopeptidase | - |
| KG893_RS08825 (WE0254_01805) | - | 1777636..1778364 (+) | 729 | WP_002378468.1 | ion transporter | - |
| KG893_RS08830 (WE0254_01806) | - | 1778464..1779612 (+) | 1149 | WP_002388210.1 | site-specific integrase | - |
| KG893_RS08835 (WE0254_01807) | comGD | 1779640..1780083 (-) | 444 | WP_025192396.1 | competence type IV pilus minor pilin ComGD | - |
| KG893_RS08840 (WE0254_01808) | comGC/cglC | 1780080..1780355 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| KG893_RS08845 (WE0254_01809) | comGB | 1780355..1781401 (-) | 1047 | WP_002356990.1 | competence type IV pilus assembly protein ComGB | - |
| KG893_RS08850 (WE0254_01810) | comGA | 1781358..1782326 (-) | 969 | WP_002364362.1 | competence type IV pilus ATPase ComGA | - |
| KG893_RS08855 (WE0254_01811) | - | 1782567..1783895 (-) | 1329 | WP_002356988.1 | APC family permease | - |
| KG893_RS08860 (WE0254_01812) | rlmN | 1784185..1785258 (-) | 1074 | WP_221595532.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
| KG893_RS08865 (WE0254_01813) | - | 1785384..1787213 (-) | 1830 | WP_002398606.1 | ABC transporter permease | - |
| KG893_RS08870 (WE0254_01814) | - | 1787203..1787952 (-) | 750 | WP_002381711.1 | ABC transporter ATP-binding protein | - |
| KG893_RS08875 (WE0254_01815) | - | 1788070..1788771 (-) | 702 | WP_002364244.1 | GntR family transcriptional regulator | - |
| KG893_RS08880 (WE0254_01816) | - | 1788902..1791325 (-) | 2424 | WP_002380448.1 | DNA translocase FtsK | - |
| KG893_RS08885 (WE0254_01817) | - | 1791639..1792850 (-) | 1212 | WP_002380449.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| KG893_RS08890 (WE0254_01818) | - | 1792879..1793784 (-) | 906 | WP_002360016.1 | prenyltransferase | - |
| KG893_RS08895 (WE0254_01819) | - | 1793906..1794886 (+) | 981 | WP_002360015.1 | polyprenyl synthetase family protein | - |
| KG893_RS08900 (WE0254_01820) | cydC | 1794966..1796732 (-) | 1767 | WP_002381710.1 | thiol reductant ABC exporter subunit CydC | - |
| KG893_RS08905 (WE0254_01821) | cydD | 1796729..1798462 (-) | 1734 | WP_002381709.1 | thiol reductant ABC exporter subunit CydD | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=1150766 KG893_RS08840 WP_002356991.1 1780080..1780355(-) (comGC/cglC) [Enterococcus faecalis isolate WE0254]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=1150766 KG893_RS08840 WP_002356991.1 1780080..1780355(-) (comGC/cglC) [Enterococcus faecalis isolate WE0254]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTCCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |