Detailed information
Bioinformatically predicted
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | KJA91_RS09585 | Genome accession | NZ_OD940420 |
| Coordinates | 1965460..1965735 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis isolate WE0438 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1925190..1965436 | 1965460..1965735 | flank | 24 |
Gene organization within MGE regions
Location: 1925190..1965735
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KJA91_RS09310 (WE0438_01902) | - | 1925190..1926197 (-) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| KJA91_RS09315 (WE0438_01903) | comGG | 1926326..1926679 (-) | 354 | WP_002377063.1 | competence type IV pilus minor pilin ComGG | - |
| KJA91_RS09320 (WE0438_01904) | comGF | 1926679..1927113 (-) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| KJA91_RS09325 (WE0438_01905) | - | 1927103..1927429 (-) | 327 | WP_010712601.1 | type II secretion system protein | - |
| KJA91_RS09330 (WE0438_01907) | hemH | 1928230..1929171 (-) | 942 | WP_002357056.1 | ferrochelatase | - |
| KJA91_RS09340 (WE0438_01909) | - | 1929887..1930159 (-) | 273 | WP_002378444.1 | hypothetical protein | - |
| KJA91_RS09345 (WE0438_01910) | - | 1930231..1930431 (-) | 201 | WP_002357053.1 | cold-shock protein | - |
| KJA91_RS09350 (WE0438_01911) | - | 1931284..1932543 (-) | 1260 | WP_010712602.1 | LysM peptidoglycan-binding domain-containing protein | - |
| KJA91_RS09355 (WE0438_01912) | - | 1932556..1932936 (-) | 381 | WP_002378446.1 | phage holin family protein | - |
| KJA91_RS09360 (WE0438_01913) | - | 1932947..1933069 (-) | 123 | WP_002368228.1 | XkdX family protein | - |
| KJA91_RS09365 (WE0438_01914) | - | 1933071..1933466 (-) | 396 | WP_002363385.1 | hypothetical protein | - |
| KJA91_RS09370 (WE0438_01915) | - | 1933485..1933937 (-) | 453 | WP_002363384.1 | hypothetical protein | - |
| KJA91_RS09375 (WE0438_01916) | - | 1933954..1934694 (-) | 741 | WP_113821373.1 | hypothetical protein | - |
| KJA91_RS09380 (WE0438_01917) | - | 1934700..1936145 (-) | 1446 | WP_213044511.1 | phage tail spike protein | - |
| KJA91_RS09385 (WE0438_01918) | - | 1936145..1936867 (-) | 723 | WP_010785045.1 | hypothetical protein | - |
| KJA91_RS09390 (WE0438_01919) | - | 1936864..1941318 (-) | 4455 | WP_104880985.1 | phage tail tape measure protein | - |
| KJA91_RS09395 (WE0438_01920) | - | 1941305..1941610 (-) | 306 | WP_002366371.1 | hypothetical protein | - |
| KJA91_RS09400 (WE0438_01921) | - | 1941679..1942077 (-) | 399 | WP_002378449.1 | tail assembly chaperone | - |
| KJA91_RS09405 (WE0438_01922) | - | 1942131..1942703 (-) | 573 | WP_025189338.1 | immunoglobulin-like domain-containing protein | - |
| KJA91_RS09410 (WE0438_01923) | - | 1942752..1942934 (-) | 183 | WP_002378453.1 | hypothetical protein | - |
| KJA91_RS09415 (WE0438_01924) | - | 1942937..1943542 (-) | 606 | WP_002364302.1 | phage major tail protein, TP901-1 family | - |
| KJA91_RS09420 (WE0438_01925) | - | 1943561..1943953 (-) | 393 | WP_002363373.1 | DUF3168 domain-containing protein | - |
| KJA91_RS09425 (WE0438_01926) | - | 1943950..1944288 (-) | 339 | WP_002363372.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| KJA91_RS09430 (WE0438_01927) | - | 1944285..1944560 (-) | 276 | WP_002378454.1 | hypothetical protein | - |
| KJA91_RS09435 (WE0438_01928) | - | 1944557..1944889 (-) | 333 | WP_002363369.1 | phage head-tail connector protein | - |
| KJA91_RS09440 (WE0438_01929) | - | 1944960..1945856 (-) | 897 | WP_002378455.1 | hypothetical protein | - |
| KJA91_RS09445 (WE0438_01930) | - | 1945870..1946505 (-) | 636 | WP_010710204.1 | DUF4355 domain-containing protein | - |
| KJA91_RS09450 (WE0438_01931) | - | 1946628..1947554 (-) | 927 | WP_002378457.1 | minor capsid protein | - |
| KJA91_RS09455 (WE0438_01932) | - | 1947547..1949031 (-) | 1485 | WP_010784607.1 | phage portal protein | - |
| KJA91_RS09460 (WE0438_01933) | - | 1949031..1950314 (-) | 1284 | WP_010712607.1 | PBSX family phage terminase large subunit | - |
| KJA91_RS09465 (WE0438_01934) | - | 1950295..1950729 (-) | 435 | WP_002364295.1 | terminase small subunit | - |
| KJA91_RS14615 | - | 1950761..1950991 (-) | 231 | Protein_1849 | hypothetical protein | - |
| KJA91_RS09470 (WE0438_01935) | - | 1951462..1951824 (-) | 363 | WP_224800088.1 | hypothetical protein | - |
| KJA91_RS09475 (WE0438_01936) | - | 1951941..1952630 (-) | 690 | WP_010712608.1 | hypothetical protein | - |
| KJA91_RS09485 (WE0438_01939) | - | 1953563..1953979 (-) | 417 | WP_002357018.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| KJA91_RS09490 (WE0438_01940) | - | 1954887..1955294 (-) | 408 | WP_002378462.1 | RusA family crossover junction endodeoxyribonuclease | - |
| KJA91_RS09495 (WE0438_01941) | - | 1955291..1956148 (-) | 858 | WP_002364343.1 | helix-turn-helix domain-containing protein | - |
| KJA91_RS09500 (WE0438_01942) | - | 1956148..1956348 (-) | 201 | WP_002357010.1 | hypothetical protein | - |
| KJA91_RS09505 (WE0438_01943) | - | 1956353..1956994 (-) | 642 | WP_002364344.1 | putative HNHc nuclease | - |
| KJA91_RS09510 (WE0438_01944) | - | 1956999..1957733 (-) | 735 | WP_002378463.1 | ERF family protein | - |
| KJA91_RS09515 (WE0438_01945) | - | 1957726..1958043 (-) | 318 | WP_002357007.1 | hypothetical protein | - |
| KJA91_RS09520 (WE0438_01946) | - | 1958263..1958817 (+) | 555 | WP_002357006.1 | hypothetical protein | - |
| KJA91_RS09525 (WE0438_01948) | - | 1959102..1959440 (-) | 339 | WP_002357003.1 | hypothetical protein | - |
| KJA91_RS09530 (WE0438_01949) | - | 1959477..1959686 (-) | 210 | WP_002357002.1 | hypothetical protein | - |
| KJA91_RS09535 | - | 1959741..1959929 (+) | 189 | WP_002357001.1 | YegP family protein | - |
| KJA91_RS09540 (WE0438_01950) | - | 1959955..1960677 (-) | 723 | WP_002357000.1 | phage regulatory protein | - |
| KJA91_RS09545 (WE0438_01951) | - | 1960700..1961011 (-) | 312 | WP_002381719.1 | hypothetical protein | - |
| KJA91_RS14775 | - | 1961023..1961190 (-) | 168 | WP_002388204.1 | hypothetical protein | - |
| KJA91_RS09550 (WE0438_01953) | - | 1961608..1961805 (-) | 198 | WP_010712611.1 | hypothetical protein | - |
| KJA91_RS09555 (WE0438_01954) | - | 1961818..1962000 (-) | 183 | WP_002388205.1 | hypothetical protein | - |
| KJA91_RS09560 (WE0438_01955) | - | 1962260..1962595 (+) | 336 | WP_002388206.1 | helix-turn-helix transcriptional regulator | - |
| KJA91_RS09565 (WE0438_01956) | - | 1962614..1962958 (+) | 345 | WP_002388207.1 | ImmA/IrrE family metallo-endopeptidase | - |
| KJA91_RS09570 (WE0438_01957) | - | 1963016..1963744 (+) | 729 | WP_002388208.1 | potassium channel family protein | - |
| KJA91_RS09575 (WE0438_01958) | - | 1963844..1964992 (+) | 1149 | WP_002388210.1 | site-specific integrase | - |
| KJA91_RS09580 (WE0438_01959) | comGD | 1965020..1965463 (-) | 444 | WP_002388212.1 | competence type IV pilus minor pilin ComGD | - |
| KJA91_RS09585 (WE0438_01960) | comGC/cglC | 1965460..1965735 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=1150581 KJA91_RS09585 WP_002356991.1 1965460..1965735(-) (comGC/cglC) [Enterococcus faecalis isolate WE0438]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=1150581 KJA91_RS09585 WP_002356991.1 1965460..1965735(-) (comGC/cglC) [Enterococcus faecalis isolate WE0438]
ATGAAAAAGAAACAAAAATACGCAGGTTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGTTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |