Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | LLA12_RS09600 | Genome accession | NZ_LT599049 |
| Coordinates | 1988774..1989199 (-) | Length | 141 a.a. |
| NCBI ID | WP_021722238.1 | Uniprot ID | - |
| Organism | Lactococcus lactis subsp. lactis strain A12 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1959023..1997446 | 1988774..1989199 | within | 0 |
Gene organization within MGE regions
Location: 1959023..1997446
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLA12_RS09380 (LLA12_01996) | - | 1959023..1959319 (-) | 297 | WP_021722194.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| LLA12_RS09385 (LLA12_01997) | - | 1959490..1959711 (-) | 222 | WP_023349381.1 | hypothetical protein | - |
| LLA12_RS09390 (LLA12_01998) | - | 1959757..1960536 (-) | 780 | WP_021722195.1 | peptidoglycan amidohydrolase family protein | - |
| LLA12_RS09395 (LLA12_01999) | - | 1960536..1960811 (-) | 276 | WP_021722196.1 | holin | - |
| LLA12_RS09400 (LLA12_02000) | - | 1960824..1961048 (-) | 225 | WP_021722197.1 | hemolysin XhlA family protein | - |
| LLA12_RS13800 (LLA12_02001) | - | 1961061..1962371 (-) | 1311 | WP_231947334.1 | hypothetical protein | - |
| LLA12_RS13965 (LLA12_02002) | - | 1962464..1962601 (-) | 138 | WP_021722199.1 | hypothetical protein | - |
| LLA12_RS09410 (LLA12_02003) | - | 1962598..1965027 (-) | 2430 | WP_021722200.1 | gp58-like family protein | - |
| LLA12_RS09415 (LLA12_02004) | - | 1965039..1965404 (-) | 366 | WP_021722201.1 | DUF6711 family protein | - |
| LLA12_RS09420 (LLA12_02005) | - | 1965416..1970197 (-) | 4782 | WP_021722202.1 | SLT domain protein | - |
| LLA12_RS09425 (LLA12_02006) | - | 1970229..1970600 (-) | 372 | WP_021722203.1 | hypothetical protein | - |
| LLA12_RS09430 (LLA12_02007) | - | 1970624..1971034 (-) | 411 | WP_021722204.1 | DUF6096 family protein | - |
| LLA12_RS09435 (LLA12_02008) | - | 1971108..1971533 (-) | 426 | WP_021722205.1 | phage tail tube protein | - |
| LLA12_RS09440 (LLA12_02009) | - | 1971546..1971908 (-) | 363 | WP_021722206.1 | hypothetical protein | - |
| LLA12_RS09445 (LLA12_02010) | - | 1971908..1972456 (-) | 549 | WP_032946647.1 | hypothetical protein | - |
| LLA12_RS09450 (LLA12_02011) | - | 1972440..1972793 (-) | 354 | WP_032946648.1 | hypothetical protein | - |
| LLA12_RS09455 (LLA12_02012) | - | 1972774..1973103 (-) | 330 | WP_021722209.1 | phage head-tail connector protein | - |
| LLA12_RS13970 (LLA12_02013) | - | 1973110..1973283 (-) | 174 | WP_021722210.1 | hypothetical protein | - |
| LLA12_RS09460 (LLA12_02014) | - | 1973287..1974156 (-) | 870 | WP_021722211.1 | phage major capsid protein | - |
| LLA12_RS09465 (LLA12_02015) | - | 1974168..1974824 (-) | 657 | WP_021722212.1 | DUF4355 domain-containing protein | - |
| LLA12_RS09470 (LLA12_02016) | - | 1974989..1976095 (-) | 1107 | WP_021722213.1 | minor capsid protein | - |
| LLA12_RS09475 (LLA12_02017) | - | 1976101..1976388 (-) | 288 | WP_021722214.1 | ribosomal-processing cysteine protease Prp | - |
| LLA12_RS13975 (LLA12_02018) | - | 1976385..1976549 (-) | 165 | WP_167349361.1 | hypothetical protein | - |
| LLA12_RS09480 (LLA12_02019) | - | 1976506..1978014 (-) | 1509 | WP_021722216.1 | phage portal protein | - |
| LLA12_RS09485 (LLA12_02020) | - | 1978023..1979257 (-) | 1235 | Protein_1869 | PBSX family phage terminase large subunit | - |
| LLA12_RS09490 (LLA12_02021) | - | 1979247..1979759 (-) | 513 | WP_021722218.1 | terminase small subunit | - |
| LLA12_RS09495 (LLA12_02022) | - | 1980223..1980645 (-) | 423 | WP_021722219.1 | RinA family protein | - |
| LLA12_RS09500 (LLA12_02024) | - | 1981263..1981472 (+) | 210 | WP_021722221.1 | hypothetical protein | - |
| LLA12_RS09505 | - | 1981524..1981706 (-) | 183 | WP_021722222.1 | DUF1660 domain-containing protein | - |
| LLA12_RS09510 (LLA12_02026) | - | 1981703..1981921 (-) | 219 | WP_021722223.1 | hypothetical protein | - |
| LLA12_RS09515 (LLA12_02027) | - | 1981940..1982275 (-) | 336 | WP_068872834.1 | DUF1140 family protein | - |
| LLA12_RS09520 (LLA12_02028) | - | 1982272..1982556 (-) | 285 | WP_021722225.1 | hypothetical protein | - |
| LLA12_RS13805 (LLA12_02029) | - | 1982546..1982872 (-) | 327 | WP_021722226.1 | hypothetical protein | - |
| LLA12_RS09530 (LLA12_02030) | dut | 1982872..1983291 (-) | 420 | WP_021722227.1 | dUTP diphosphatase | - |
| LLA12_RS09535 (LLA12_02031) | - | 1983288..1983590 (-) | 303 | WP_231947335.1 | hypothetical protein | - |
| LLA12_RS09540 (LLA12_02032) | - | 1983608..1984159 (-) | 552 | WP_021722229.1 | DUF1642 domain-containing protein | - |
| LLA12_RS09545 (LLA12_02033) | - | 1984152..1984358 (-) | 207 | WP_010905356.1 | DUF1125 domain-containing protein | - |
| LLA12_RS09550 (LLA12_02034) | - | 1984359..1984619 (-) | 261 | WP_021722230.1 | hypothetical protein | - |
| LLA12_RS09555 (LLA12_02035) | - | 1984624..1984932 (-) | 309 | WP_032946652.1 | hypothetical protein | - |
| LLA12_RS09560 (LLA12_02036) | - | 1984941..1985450 (-) | 510 | WP_021722232.1 | phage protein | - |
| LLA12_RS09565 (LLA12_02037) | - | 1985461..1985826 (-) | 366 | WP_032946654.1 | DUF658 family protein | - |
| LLA12_RS09570 (LLA12_02038) | - | 1985801..1985965 (-) | 165 | WP_021722234.1 | hypothetical protein | - |
| LLA12_RS09575 (LLA12_02039) | - | 1986076..1986312 (-) | 237 | WP_032946700.1 | DUF1031 family protein | - |
| LLA12_RS09580 (LLA12_02040) | - | 1986444..1986818 (-) | 375 | WP_021722235.1 | DUF1064 domain-containing protein | - |
| LLA12_RS14190 (LLA12_02041) | - | 1986815..1987243 (-) | 429 | WP_230473239.1 | hypothetical protein | - |
| LLA12_RS14195 (LLA12_02042) | - | 1987325..1987540 (-) | 216 | WP_230473240.1 | hypothetical protein | - |
| LLA12_RS09590 (LLA12_02043) | - | 1987540..1988322 (-) | 783 | WP_021722236.1 | phage replisome organizer protein | - |
| LLA12_RS09595 (LLA12_02044) | - | 1988322..1988648 (-) | 327 | WP_021722237.1 | HNH endonuclease | - |
| LLA12_RS09600 (LLA12_02045) | ssb | 1988774..1989199 (-) | 426 | WP_021722238.1 | single-stranded DNA-binding protein | Machinery gene |
| LLA12_RS09605 (LLA12_02046) | - | 1989196..1989951 (-) | 756 | WP_021722239.1 | Rad52/Rad22 family DNA repair protein | - |
| LLA12_RS09610 (LLA12_02047) | - | 1989960..1990355 (-) | 396 | WP_011835837.1 | hypothetical protein | - |
| LLA12_RS09615 (LLA12_02048) | - | 1990470..1990685 (-) | 216 | WP_021722240.1 | DUF1408 domain-containing protein | - |
| LLA12_RS09620 (LLA12_02049) | - | 1990789..1991223 (+) | 435 | WP_032946657.1 | hypothetical protein | - |
| LLA12_RS13810 | - | 1991213..1991365 (-) | 153 | WP_155242617.1 | hypothetical protein | - |
| LLA12_RS14340 (LLA12_02050) | - | 1991381..1991509 (-) | 129 | WP_021722242.1 | hypothetical protein | - |
| LLA12_RS09625 (LLA12_02051) | - | 1991523..1991783 (-) | 261 | WP_021722243.1 | hypothetical protein | - |
| LLA12_RS09630 (LLA12_02052) | - | 1991797..1992534 (-) | 738 | WP_021722244.1 | ORF6C domain-containing protein | - |
| LLA12_RS09635 (LLA12_02053) | - | 1992565..1992783 (-) | 219 | WP_010905683.1 | DUF739 family protein | - |
| LLA12_RS09640 (LLA12_02054) | - | 1992952..1993494 (+) | 543 | WP_021722245.1 | helix-turn-helix domain-containing protein | - |
| LLA12_RS09645 (LLA12_02055) | - | 1993491..1993928 (+) | 438 | WP_021722246.1 | ImmA/IrrE family metallo-endopeptidase | - |
| LLA12_RS09650 (LLA12_02056) | - | 1993991..1994572 (+) | 582 | WP_068872835.1 | hypothetical protein | - |
| LLA12_RS09655 (LLA12_02057) | - | 1994692..1995831 (+) | 1140 | WP_021722247.1 | tyrosine-type recombinase/integrase | - |
| LLA12_RS09660 (LLA12_02058) | sufB | 1996034..1997446 (-) | 1413 | WP_004255207.1 | Fe-S cluster assembly protein SufB | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15798.53 Da Isoelectric Point: 5.1972
>NTDB_id=1144877 LLA12_RS09600 WP_021722238.1 1988774..1989199(-) (ssb) [Lactococcus lactis subsp. lactis strain A12]
MINNVTLVGRITKEPELRYTQQNKAVASFTLAVNRQFKNANGEREADFINCVIWGKSAENLANWTHKGQLIGVIGNIQTR
NYENQQGQRVYVTEVVASNFQVLEKSNQVNGERVGNPAAKPQNNDSFGNDPMEISDDDLPF
MINNVTLVGRITKEPELRYTQQNKAVASFTLAVNRQFKNANGEREADFINCVIWGKSAENLANWTHKGQLIGVIGNIQTR
NYENQQGQRVYVTEVVASNFQVLEKSNQVNGERVGNPAAKPQNNDSFGNDPMEISDDDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=1144877 LLA12_RS09600 WP_021722238.1 1988774..1989199(-) (ssb) [Lactococcus lactis subsp. lactis strain A12]
ATGATTAACAATGTCACTCTAGTAGGAAGAATCACTAAAGAACCTGAACTTAGATATACACAACAAAATAAAGCAGTTGC
TTCATTTACTCTTGCAGTTAATCGTCAATTTAAAAATGCTAATGGAGAAAGAGAAGCTGACTTCATCAATTGTGTTATCT
GGGGTAAATCAGCCGAAAACTTGGCCAATTGGACTCATAAAGGTCAATTAATTGGAGTTATTGGGAATATCCAAACTCGA
AACTATGAGAACCAACAAGGGCAACGTGTTTATGTTACGGAGGTTGTCGCAAGTAATTTCCAAGTACTAGAAAAAAGTAA
TCAAGTAAATGGTGAACGAGTTGGTAATCCAGCTGCAAAACCACAAAATAACGATTCTTTTGGAAATGATCCAATGGAAA
TTTCAGATGATGACCTGCCATTTTAA
ATGATTAACAATGTCACTCTAGTAGGAAGAATCACTAAAGAACCTGAACTTAGATATACACAACAAAATAAAGCAGTTGC
TTCATTTACTCTTGCAGTTAATCGTCAATTTAAAAATGCTAATGGAGAAAGAGAAGCTGACTTCATCAATTGTGTTATCT
GGGGTAAATCAGCCGAAAACTTGGCCAATTGGACTCATAAAGGTCAATTAATTGGAGTTATTGGGAATATCCAAACTCGA
AACTATGAGAACCAACAAGGGCAACGTGTTTATGTTACGGAGGTTGTCGCAAGTAATTTCCAAGTACTAGAAAAAAGTAA
TCAAGTAAATGGTGAACGAGTTGGTAATCCAGCTGCAAAACCACAAAATAACGATTCTTTTGGAAATGATCCAATGGAAA
TTTCAGATGATGACCTGCCATTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.882 |
100 |
0.674 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
52.326 |
100 |
0.638 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
44.681 |
100 |
0.447 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
44.681 |
100 |
0.447 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
43.972 |
100 |
0.44 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
43.972 |
100 |
0.44 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
43.972 |
100 |
0.44 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
43.972 |
100 |
0.44 |
| ssbB/cilA | Streptococcus mitis SK321 |
43.972 |
100 |
0.44 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.654 |
73.759 |
0.433 |
| ssbA | Streptococcus mutans UA159 |
39.716 |
100 |
0.397 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
49.515 |
73.05 |
0.362 |