Detailed information
Overview
| Name | ssbB/cilA | Type | Machinery gene |
| Locus tag | DQL01_RS09860 | Genome accession | NZ_LS483451 |
| Coordinates | 1840234..1840629 (-) | Length | 131 a.a. |
| NCBI ID | WP_000282467.1 | Uniprot ID | A0A098Z0L0 |
| Organism | Streptococcus pneumoniae strain 4041STDY6836166 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1836269..1858894 | 1840234..1840629 | within | 0 |
| IS/Tn | 1838404..1839693 | 1840234..1840629 | flank | 541 |
Gene organization within MGE regions
Location: 1836269..1858894
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DQL01_RS09840 | groL | 1836269..1837891 (-) | 1623 | WP_000031573.1 | chaperonin GroEL | - |
| DQL01_RS09845 | groES | 1837907..1838191 (-) | 285 | WP_000917330.1 | co-chaperone GroES | - |
| DQL01_RS09850 | - | 1838404..1839801 (+) | 1398 | Protein_1865 | ISNCY family transposase | - |
| DQL01_RS12675 | - | 1839874..1839999 (+) | 126 | WP_001258158.1 | hypothetical protein | - |
| DQL01_RS09860 | ssbB/cilA | 1840234..1840629 (-) | 396 | WP_000282467.1 | single-stranded DNA-binding protein | Machinery gene |
| DQL01_RS09865 | - | 1840706..1841467 (-) | 762 | WP_050115111.1 | SDR family NAD(P)-dependent oxidoreductase | - |
| DQL01_RS09870 | ytpR | 1841500..1842126 (-) | 627 | WP_000578309.1 | YtpR family tRNA-binding protein | - |
| DQL01_RS09875 | - | 1842142..1842459 (-) | 318 | WP_000615767.1 | thioredoxin family protein | - |
| DQL01_RS09880 | - | 1842456..1842755 (-) | 300 | WP_001013974.1 | DUF4651 domain-containing protein | - |
| DQL01_RS12455 | - | 1842849..1842995 (+) | 147 | WP_050125336.1 | hypothetical protein | - |
| DQL01_RS09890 | - | 1842965..1843243 (-) | 279 | WP_222149965.1 | hypothetical protein | - |
| DQL01_RS09895 | - | 1843403..1844077 (-) | 675 | WP_000725749.1 | LiaF transmembrane domain-containing protein | - |
| DQL01_RS09900 | - | 1844083..1844529 (-) | 447 | WP_000776589.1 | LytTR family DNA-binding domain-containing protein | - |
| DQL01_RS09905 | - | 1844643..1845146 (-) | 504 | WP_000800942.1 | phosphatase PAP2 family protein | - |
| DQL01_RS09910 | - | 1845143..1845505 (-) | 363 | WP_000078805.1 | DUF2200 domain-containing protein | - |
| DQL01_RS12460 | rcrQ | 1845571..1846602 (-) | 1032 | WP_138038883.1 | ABC transporter ATP-binding protein | Regulator |
| DQL01_RS12465 | - | 1846609..1847432 (-) | 824 | Protein_1879 | ABC transporter permease | - |
| DQL01_RS09920 | - | 1847449..1847920 (-) | 472 | Protein_1880 | MarR family winged helix-turn-helix transcriptional regulator | - |
| DQL01_RS09930 | - | 1848044..1848760 (-) | 717 | WP_000532876.1 | YebC/PmpR family DNA-binding transcriptional regulator | - |
| DQL01_RS09940 | ply | 1849641..1851056 (-) | 1416 | WP_001284359.1 | cholesterol-dependent cytolysin pneumolysin | - |
| DQL01_RS09945 | - | 1851067..1851477 (-) | 411 | WP_000595764.1 | hypothetical protein | - |
| DQL01_RS09950 | - | 1851470..1852078 (-) | 609 | WP_000083614.1 | hypothetical protein | - |
| DQL01_RS09955 | - | 1852091..1852549 (-) | 459 | WP_000186955.1 | DUF4231 domain-containing protein | - |
| DQL01_RS09960 | - | 1852674..1853073 (+) | 400 | Protein_1886 | transposase family protein | - |
| DQL01_RS09965 | - | 1853551..1854384 (+) | 834 | WP_044793671.1 | glycerophosphodiester phosphodiesterase family protein | - |
| DQL01_RS09970 | - | 1854403..1855464 (+) | 1062 | WP_000475762.1 | extracellular solute-binding protein | - |
| DQL01_RS09975 | - | 1855481..1856485 (+) | 1005 | WP_061841860.1 | ABC transporter ATP-binding protein | - |
| DQL01_RS09980 | - | 1856497..1858191 (+) | 1695 | WP_069288023.1 | ABC transporter permease | - |
| DQL01_RS09985 | - | 1858193..1858894 (+) | 702 | WP_001054457.1 | MgtC/SapB family protein | - |
Sequence
Protein
Download Length: 131 a.a. Molecular weight: 14925.89 Da Isoelectric Point: 5.9409
>NTDB_id=1142079 DQL01_RS09860 WP_000282467.1 1840234..1840629(-) (ssbB/cilA) [Streptococcus pneumoniae strain 4041STDY6836166]
MYNKVIMIGRLTSTPELHKTNNDKSVARATIAVNRRYKDQNGEREADFVNMVLWGRLAETLASYATKGSLISVDGELRTR
RFEKNGQMNYVTEVLVTGFQLLESRAQRAMRENNAGQDLADLVLEEEELPF
MYNKVIMIGRLTSTPELHKTNNDKSVARATIAVNRRYKDQNGEREADFVNMVLWGRLAETLASYATKGSLISVDGELRTR
RFEKNGQMNYVTEVLVTGFQLLESRAQRAMRENNAGQDLADLVLEEEELPF
Nucleotide
Download Length: 396 bp
>NTDB_id=1142079 DQL01_RS09860 WP_000282467.1 1840234..1840629(-) (ssbB/cilA) [Streptococcus pneumoniae strain 4041STDY6836166]
ATGTATAATAAAGTTATCATGATTGGGCGTTTAACGTCTACACCAGAATTGCACAAAACCAACAATGACAAGTCGGTAGC
GCGAGCAACTATCGCTGTCAACCGTCGTTACAAAGACCAAAACGGTGAACGTGAAGCTGATTTTGTCAATATGGTCCTAT
GGGGCAGACTAGCAGAAACTTTGGCAAGCTACGCAACCAAAGGTAGTCTCATTTCCGTTGATGGAGAATTGCGTACCCGT
CGCTTTGAGAAAAATGGTCAGATGAACTATGTAACCGAAGTCCTTGTGACAGGATTCCAACTCTTAGAAAGTCGTGCTCA
ACGTGCCATGCGTGAAAATAATGCAGGCCAAGATTTGGCAGATTTGGTCTTGGAAGAGGAAGAATTGCCATTTTAA
ATGTATAATAAAGTTATCATGATTGGGCGTTTAACGTCTACACCAGAATTGCACAAAACCAACAATGACAAGTCGGTAGC
GCGAGCAACTATCGCTGTCAACCGTCGTTACAAAGACCAAAACGGTGAACGTGAAGCTGATTTTGTCAATATGGTCCTAT
GGGGCAGACTAGCAGAAACTTTGGCAAGCTACGCAACCAAAGGTAGTCTCATTTCCGTTGATGGAGAATTGCGTACCCGT
CGCTTTGAGAAAAATGGTCAGATGAACTATGTAACCGAAGTCCTTGTGACAGGATTCCAACTCTTAGAAAGTCGTGCTCA
ACGTGCCATGCGTGAAAATAATGCAGGCCAAGATTTGGCAGATTTGGTCTTGGAAGAGGAAGAATTGCCATTTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbB/cilA | Streptococcus pneumoniae D39 |
100 |
100 |
1 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
100 |
100 |
1 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
100 |
100 |
1 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
99.237 |
100 |
0.992 |
| ssbB/cilA | Streptococcus mitis SK321 |
98.473 |
100 |
0.985 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
98.473 |
100 |
0.985 |
| ssbA | Streptococcus mutans UA159 |
74.809 |
100 |
0.748 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
70.229 |
100 |
0.702 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
59.821 |
85.496 |
0.511 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
50.943 |
80.916 |
0.412 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
46.903 |
86.26 |
0.405 |