Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | E0E09_RS10600 | Genome accession | NZ_LR027869 |
| Coordinates | 2033594..2034022 (-) | Length | 142 a.a. |
| NCBI ID | WP_000934775.1 | Uniprot ID | - |
| Organism | Staphylococcus aureus isolate BPH2869 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1997846..2043239 | 2033594..2034022 | within | 0 |
Gene organization within MGE regions
Location: 1997846..2043239
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E0E09_RS10325 | - | 1997846..1998361 (-) | 516 | WP_000163283.1 | type 1 glutamine amidotransferase domain-containing protein | - |
| E0E09_RS10330 | - | 1998492..1998653 (-) | 162 | WP_001005408.1 | SE1561 family protein | - |
| E0E09_RS10335 | - | 1999000..1999080 (+) | 81 | WP_100250272.1 | hypothetical protein | - |
| E0E09_RS10350 | - | 1999667..2001112 (-) | 1446 | WP_001148138.1 | SH3 domain-containing protein | - |
| E0E09_RS10355 | - | 2001093..2001530 (-) | 438 | WP_000354132.1 | phage holin | - |
| E0E09_RS10360 | - | 2001586..2001981 (-) | 396 | WP_000398878.1 | hypothetical protein | - |
| E0E09_RS10365 | - | 2001987..2003159 (-) | 1173 | WP_130826618.1 | BppU family phage baseplate upper protein | - |
| E0E09_RS10370 | - | 2003172..2005070 (-) | 1899 | WP_130826619.1 | glucosaminidase domain-containing protein | - |
| E0E09_RS10375 | - | 2005207..2005506 (-) | 300 | WP_000466769.1 | DUF2951 domain-containing protein | - |
| E0E09_RS10380 | - | 2005547..2005720 (-) | 174 | WP_001790193.1 | XkdX family protein | - |
| E0E09_RS10385 | - | 2005724..2006101 (-) | 378 | WP_000705893.1 | DUF2977 domain-containing protein | - |
| E0E09_RS10390 | - | 2006101..2007924 (-) | 1824 | WP_000634520.1 | phage baseplate upper protein | - |
| E0E09_RS10395 | - | 2007924..2009834 (-) | 1911 | WP_130826620.1 | hypothetical protein | - |
| E0E09_RS10400 | - | 2009849..2011750 (-) | 1902 | WP_000156406.1 | SGNH/GDSL hydrolase family protein | - |
| E0E09_RS10405 | - | 2011759..2012706 (-) | 948 | WP_000350680.1 | phage tail family protein | - |
| E0E09_RS10410 | - | 2012719..2016183 (-) | 3465 | WP_130826621.1 | hypothetical protein | - |
| E0E09_RS10415 | - | 2016200..2016544 (-) | 345 | WP_000105584.1 | hypothetical protein | - |
| E0E09_RS10420 | - | 2016574..2016939 (-) | 366 | WP_001100161.1 | tail assembly chaperone | - |
| E0E09_RS10425 | - | 2017001..2017582 (-) | 582 | WP_000002577.1 | phage major tail protein, TP901-1 family | - |
| E0E09_RS10430 | - | 2017601..2017984 (-) | 384 | WP_000188651.1 | hypothetical protein | - |
| E0E09_RS10435 | - | 2017996..2018343 (-) | 348 | WP_001017815.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| E0E09_RS10440 | - | 2018343..2018645 (-) | 303 | WP_001268312.1 | hypothetical protein | - |
| E0E09_RS10445 | - | 2018642..2018974 (-) | 333 | WP_000208960.1 | phage head-tail connector protein | - |
| E0E09_RS10450 | - | 2018983..2019270 (-) | 288 | WP_001114086.1 | hypothetical protein | - |
| E0E09_RS10455 | - | 2019292..2020266 (-) | 975 | WP_000438511.1 | phage major capsid protein | - |
| E0E09_RS10460 | - | 2020280..2020900 (-) | 621 | WP_000392151.1 | DUF4355 domain-containing protein | - |
| E0E09_RS16065 | - | 2020894..2020981 (-) | 88 | Protein_1927 | hypothetical protein | - |
| E0E09_RS10465 | - | 2021009..2021179 (-) | 171 | WP_000072208.1 | hypothetical protein | - |
| E0E09_RS10470 | - | 2021252..2022247 (-) | 996 | WP_025176340.1 | minor capsid protein | - |
| E0E09_RS10475 | - | 2022254..2023789 (-) | 1536 | WP_000921888.1 | phage portal protein | - |
| E0E09_RS10480 | - | 2023800..2025077 (-) | 1278 | WP_000169946.1 | PBSX family phage terminase large subunit | - |
| E0E09_RS10485 | - | 2025064..2025504 (-) | 441 | WP_001566315.1 | terminase small subunit | - |
| E0E09_RS10490 | - | 2025691..2026110 (-) | 420 | WP_000058632.1 | transcriptional regulator | - |
| E0E09_RS10495 | - | 2026125..2026271 (-) | 147 | WP_000990007.1 | hypothetical protein | - |
| E0E09_RS10500 | rinB | 2026272..2026445 (-) | 174 | WP_025174872.1 | transcriptional activator RinB | - |
| E0E09_RS10505 | - | 2026448..2026648 (-) | 201 | WP_001125015.1 | hypothetical protein | - |
| E0E09_RS10510 | - | 2026623..2026811 (-) | 189 | WP_000195817.1 | DUF1381 domain-containing protein | - |
| E0E09_RS10515 | - | 2026828..2027001 (-) | 174 | WP_001209216.1 | hypothetical protein | - |
| E0E09_RS10520 | - | 2027038..2027571 (-) | 534 | WP_015984502.1 | dUTP diphosphatase | - |
| E0E09_RS10525 | - | 2027564..2027734 (-) | 171 | WP_000714412.1 | hypothetical protein | - |
| E0E09_RS10530 | - | 2027721..2027975 (-) | 255 | WP_001647735.1 | DUF1024 family protein | - |
| E0E09_RS10535 | - | 2027968..2028252 (-) | 285 | WP_001105618.1 | hypothetical protein | - |
| E0E09_RS10540 | - | 2028249..2028650 (-) | 402 | WP_000695766.1 | hypothetical protein | - |
| E0E09_RS10545 | - | 2028663..2028905 (-) | 243 | WP_000228426.1 | phi PVL orf 51-like protein | - |
| E0E09_RS16170 | - | 2028909..2029522 (-) | 614 | Protein_1945 | SA1788 family PVL leukocidin-associated protein | - |
| E0E09_RS10560 | - | 2029523..2029708 (-) | 186 | WP_001187254.1 | DUF3113 family protein | - |
| E0E09_RS10565 | - | 2029713..2030117 (-) | 405 | WP_000049777.1 | DUF1064 domain-containing protein | - |
| E0E09_RS10570 | - | 2030127..2030348 (-) | 222 | WP_001123680.1 | DUF3269 family protein | - |
| E0E09_RS10575 | - | 2030352..2030567 (-) | 216 | WP_001024405.1 | hypothetical protein | - |
| E0E09_RS10580 | - | 2030564..2031805 (-) | 1242 | WP_001106166.1 | DnaB helicase C-terminal domain-containing protein | - |
| E0E09_RS10585 | - | 2031802..2032158 (-) | 357 | WP_001132243.1 | hypothetical protein | - |
| E0E09_RS10590 | - | 2032158..2032913 (-) | 756 | WP_001037657.1 | DnaD domain protein | - |
| E0E09_RS10595 | - | 2032906..2033580 (-) | 675 | WP_001121810.1 | putative HNHc nuclease | - |
| E0E09_RS10600 | ssbA | 2033594..2034022 (-) | 429 | WP_000934775.1 | single-stranded DNA-binding protein | Machinery gene |
| E0E09_RS10605 | - | 2034022..2034675 (-) | 654 | WP_000840497.1 | ERF family protein | - |
| E0E09_RS10610 | - | 2034676..2035212 (-) | 537 | WP_001004335.1 | host-nuclease inhibitor Gam family protein | - |
| E0E09_RS10615 | - | 2035225..2035485 (-) | 261 | WP_000291101.1 | DUF1108 family protein | - |
| E0E09_RS10620 | - | 2035582..2035743 (-) | 162 | WP_000048124.1 | DUF1270 family protein | - |
| E0E09_RS10625 | - | 2035736..2035957 (-) | 222 | WP_000977378.1 | hypothetical protein | - |
| E0E09_RS10630 | - | 2036029..2036694 (+) | 666 | WP_001791098.1 | hypothetical protein | - |
| E0E09_RS16080 | - | 2036715..2036783 (-) | 69 | Protein_1961 | hypothetical protein | - |
| E0E09_RS10635 | tscA | 2036823..2037047 (-) | 225 | WP_000187184.1 | type II toxin-antitoxin system antitoxin TscA | - |
| E0E09_RS10640 | - | 2037048..2037839 (-) | 792 | WP_001148563.1 | phage antirepressor | - |
| E0E09_RS10645 | - | 2037855..2038073 (-) | 219 | WP_001198673.1 | helix-turn-helix transcriptional regulator | - |
| E0E09_RS10650 | - | 2038215..2038934 (+) | 720 | WP_000358224.1 | XRE family transcriptional regulator | - |
| E0E09_RS10655 | - | 2039004..2039171 (+) | 168 | WP_000705238.1 | hypothetical protein | - |
| E0E09_RS16085 | - | 2039311..2039487 (+) | 177 | WP_225904538.1 | hypothetical protein | - |
| E0E09_RS10660 | - | 2039489..2040016 (+) | 528 | WP_232044631.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| E0E09_RS10665 | - | 2040213..2041259 (+) | 1047 | WP_001145732.1 | tyrosine-type recombinase/integrase | - |
| E0E09_RS10670 | yfkAB | 2041304..2042449 (+) | 1146 | WP_001245448.1 | radical SAM/CxCxxxxC motif protein YfkAB | - |
| E0E09_RS10675 | - | 2042709..2043239 (-) | 531 | WP_000184383.1 | acyl-CoA thioesterase | - |
Sequence
Protein
Download Length: 142 a.a. Molecular weight: 15934.61 Da Isoelectric Point: 8.4724
>NTDB_id=1115800 E0E09_RS10600 WP_000934775.1 2033594..2034022(-) (ssbA) [Staphylococcus aureus isolate BPH2869]
MLNRTVLVGRLTKDPELRSTPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYDNKDGKRVFVTEVVADNVQFLEPKNNNQQPSNNYHQQRQTQTGNNPFDNTTAITDDDLPF
MLNRTVLVGRLTKDPELRSTPNGVNVGTFTLAVNRTFTNAQGEREADFINVVVFKKQAENVKNYLSKGSLAGVDGRLQTR
SYDNKDGKRVFVTEVVADNVQFLEPKNNNQQPSNNYHQQRQTQTGNNPFDNTTAITDDDLPF
Nucleotide
Download Length: 429 bp
>NTDB_id=1115800 E0E09_RS10600 WP_000934775.1 2033594..2034022(-) (ssbA) [Staphylococcus aureus isolate BPH2869]
ATGTTAAACAGAACAGTATTAGTAGGACGATTAACAAAAGACCCAGAATTAAGAAGCACGCCAAATGGCGTAAATGTAGG
GACATTCACATTAGCAGTAAACAGAACATTTACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAAAAACAAGCTGAAAACGTTAAAAATTACCTTTCTAAAGGATCACTGGCAGGTGTAGACGGACGATTACAAACACGT
AGCTACGATAACAAAGACGGGAAACGTGTATTTGTTACAGAAGTAGTAGCGGACAATGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAGCAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
ATGTTAAACAGAACAGTATTAGTAGGACGATTAACAAAAGACCCAGAATTAAGAAGCACGCCAAATGGCGTAAATGTAGG
GACATTCACATTAGCAGTAAACAGAACATTTACGAATGCTCAAGGCGAGCGTGAAGCAGATTTTATAAACGTAGTAGTGT
TCAAAAAACAAGCTGAAAACGTTAAAAATTACCTTTCTAAAGGATCACTGGCAGGTGTAGACGGACGATTACAAACACGT
AGCTACGATAACAAAGACGGGAAACGTGTATTTGTTACAGAAGTAGTAGCGGACAATGTTCAATTCTTAGAACCGAAGAA
TAACAACCAACAACCAAGCAACAATTATCATCAACAAAGACAAACTCAAACTGGTAATAATCCTTTTGATAATACCACTG
CGATTACTGATGATGACTTACCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
57.558 |
100 |
0.697 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50.588 |
100 |
0.606 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.491 |
74.648 |
0.437 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
41.259 |
100 |
0.415 |
| ssbA | Streptococcus mutans UA159 |
40.845 |
100 |
0.408 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
39.437 |
100 |
0.394 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
38.732 |
100 |
0.387 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
38.732 |
100 |
0.387 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
38.732 |
100 |
0.387 |
| ssbB/cilA | Streptococcus mitis SK321 |
38.732 |
100 |
0.387 |
| ssb | Glaesserella parasuis strain SC1401 |
29.282 |
100 |
0.373 |