Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | ACK2JZ_RS13095 | Genome accession | NZ_CP176623 |
| Coordinates | 2723077..2723352 (-) | Length | 91 a.a. |
| NCBI ID | WP_002380445.1 | Uniprot ID | - |
| Organism | Enterococcus faecalis strain SFAD86 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2677230..2741458 | 2723077..2723352 | within | 0 |
Gene organization within MGE regions
Location: 2677230..2741458
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACK2JZ_RS12790 | - | 2677230..2678237 (-) | 1008 | WP_002380426.1 | class I SAM-dependent methyltransferase | - |
| ACK2JZ_RS12795 | comGG | 2678366..2678719 (-) | 354 | WP_002362054.1 | competence type IV pilus minor pilin ComGG | - |
| ACK2JZ_RS12800 | comGF | 2678719..2679153 (-) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| ACK2JZ_RS12805 | - | 2679143..2679514 (-) | 372 | WP_171804888.1 | type II secretion system protein | - |
| ACK2JZ_RS12810 | - | 2679848..2679973 (+) | 126 | WP_002364184.1 | hypothetical protein | - |
| ACK2JZ_RS12815 | hemH | 2680270..2681211 (-) | 942 | WP_002364185.1 | ferrochelatase | - |
| ACK2JZ_RS12825 | - | 2681955..2682257 (-) | 303 | WP_257409305.1 | hypothetical protein | - |
| ACK2JZ_RS12830 | - | 2682329..2682529 (-) | 201 | WP_002357053.1 | cold-shock protein | - |
| ACK2JZ_RS12835 | - | 2683366..2684607 (-) | 1242 | WP_002394567.1 | LysM peptidoglycan-binding domain-containing protein | - |
| ACK2JZ_RS12840 | - | 2684608..2684841 (-) | 234 | WP_002384371.1 | phage holin | - |
| ACK2JZ_RS12845 | - | 2684834..2685055 (-) | 222 | WP_002364191.1 | hypothetical protein | - |
| ACK2JZ_RS12850 | - | 2685090..2685245 (-) | 156 | WP_002364192.1 | XkdX family protein | - |
| ACK2JZ_RS12855 | - | 2685247..2685567 (-) | 321 | WP_002389262.1 | hypothetical protein | - |
| ACK2JZ_RS12860 | - | 2685581..2686072 (-) | 492 | WP_002364194.1 | hypothetical protein | - |
| ACK2JZ_RS12865 | - | 2686072..2686359 (-) | 288 | WP_002357046.1 | collagen-like protein | - |
| ACK2JZ_RS12870 | - | 2686356..2686952 (-) | 597 | WP_002357045.1 | hypothetical protein | - |
| ACK2JZ_RS12875 | - | 2686945..2687826 (-) | 882 | WP_002357044.1 | phage baseplate upper protein | - |
| ACK2JZ_RS12880 | ltrA | 2688104..2689915 (-) | 1812 | WP_065535846.1 | group II intron reverse transcriptase/maturase | - |
| ACK2JZ_RS12885 | - | 2690597..2693299 (-) | 2703 | WP_236645956.1 | phage tail spike protein | - |
| ACK2JZ_RS12890 | - | 2693281..2694015 (-) | 735 | WP_002380434.1 | hypothetical protein | - |
| ACK2JZ_RS12895 | - | 2694005..2696902 (-) | 2898 | WP_201751548.1 | tape measure protein | - |
| ACK2JZ_RS12900 | gpG | 2697150..2697500 (-) | 351 | WP_002357039.1 | phage tail assembly chaperone G | - |
| ACK2JZ_RS12905 | - | 2697553..2698401 (-) | 849 | WP_002384363.1 | major tail protein | - |
| ACK2JZ_RS12910 | - | 2698402..2698776 (-) | 375 | WP_002357037.1 | DUF6838 family protein | - |
| ACK2JZ_RS12915 | - | 2698779..2699177 (-) | 399 | WP_002357036.1 | HK97 gp10 family phage protein | - |
| ACK2JZ_RS12920 | - | 2699170..2699538 (-) | 369 | WP_002357034.1 | hypothetical protein | - |
| ACK2JZ_RS12925 | - | 2699535..2699879 (-) | 345 | WP_002357033.1 | hypothetical protein | - |
| ACK2JZ_RS12930 | - | 2699893..2700075 (-) | 183 | WP_002357032.1 | hypothetical protein | - |
| ACK2JZ_RS12935 | - | 2700104..2700991 (-) | 888 | WP_002357030.1 | DUF5309 domain-containing protein | - |
| ACK2JZ_RS12940 | - | 2701005..2701628 (-) | 624 | WP_002393977.1 | DUF4355 domain-containing protein | - |
| ACK2JZ_RS12945 | - | 2701847..2702167 (-) | 321 | WP_002380436.1 | hypothetical protein | - |
| ACK2JZ_RS12950 | - | 2702224..2702454 (-) | 231 | WP_002380437.1 | hypothetical protein | - |
| ACK2JZ_RS12955 | - | 2702455..2704359 (-) | 1905 | WP_002393613.1 | hypothetical protein | - |
| ACK2JZ_RS12960 | - | 2704334..2705821 (-) | 1488 | WP_002393614.1 | phage portal protein | - |
| ACK2JZ_RS12965 | - | 2705833..2707122 (-) | 1290 | WP_002393615.1 | PBSX family phage terminase large subunit | - |
| ACK2JZ_RS12970 | terS | 2707094..2707898 (-) | 805 | Protein_2539 | phage terminase small subunit | - |
| ACK2JZ_RS12975 | - | 2707945..2708661 (-) | 717 | WP_002372040.1 | hypothetical protein | - |
| ACK2JZ_RS12980 | - | 2708754..2708981 (-) | 228 | WP_002372042.1 | hypothetical protein | - |
| ACK2JZ_RS12990 | - | 2711079..2711495 (-) | 417 | WP_002372045.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| ACK2JZ_RS12995 | - | 2712402..2712836 (-) | 435 | WP_002372046.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ACK2JZ_RS13000 | - | 2712845..2713144 (-) | 300 | WP_002372047.1 | MazG-like family protein | - |
| ACK2JZ_RS13005 | - | 2713145..2713447 (-) | 303 | WP_002368214.1 | hypothetical protein | - |
| ACK2JZ_RS13010 | - | 2713451..2714413 (-) | 963 | Protein_2546 | Lin1244/Lin1753 domain-containing protein | - |
| ACK2JZ_RS13015 | - | 2714427..2715317 (-) | 891 | WP_002364218.1 | recombinase RecT | - |
| ACK2JZ_RS13020 | - | 2715320..2716261 (-) | 942 | WP_002364219.1 | YqaJ viral recombinase family protein | - |
| ACK2JZ_RS13025 | - | 2716359..2716586 (-) | 228 | WP_002364220.1 | hypothetical protein | - |
| ACK2JZ_RS13030 | - | 2716586..2716909 (-) | 324 | WP_002380444.1 | hypothetical protein | - |
| ACK2JZ_RS13035 | - | 2716953..2717138 (-) | 186 | WP_002364222.1 | hypothetical protein | - |
| ACK2JZ_RS13040 | - | 2717129..2717323 (-) | 195 | WP_002364223.1 | hypothetical protein | - |
| ACK2JZ_RS13045 | - | 2717376..2717558 (+) | 183 | WP_002364224.1 | YegP family protein | - |
| ACK2JZ_RS13050 | - | 2717598..2718320 (-) | 723 | WP_002364225.1 | Rha family transcriptional regulator | - |
| ACK2JZ_RS13055 | - | 2718359..2718676 (-) | 318 | WP_002364228.1 | hypothetical protein | - |
| ACK2JZ_RS13060 | - | 2718682..2718873 (-) | 192 | WP_002356998.1 | hypothetical protein | - |
| ACK2JZ_RS13065 | - | 2719164..2719508 (+) | 345 | WP_002385819.1 | helix-turn-helix domain-containing protein | - |
| ACK2JZ_RS13070 | - | 2719513..2720160 (+) | 648 | WP_002372050.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ACK2JZ_RS13075 | - | 2720278..2721042 (+) | 765 | WP_002389030.1 | LysM peptidoglycan-binding domain-containing protein | - |
| ACK2JZ_RS13080 | - | 2721057..2721386 (+) | 330 | WP_002369911.1 | hypothetical protein | - |
| ACK2JZ_RS13085 | - | 2721461..2722609 (+) | 1149 | WP_002389015.1 | tyrosine-type recombinase/integrase | - |
| ACK2JZ_RS13090 | comGD | 2722637..2723080 (-) | 444 | WP_002356992.1 | competence type IV pilus minor pilin ComGD | - |
| ACK2JZ_RS13095 | comGC/cglC | 2723077..2723352 (-) | 276 | WP_002380445.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| ACK2JZ_RS13100 | comGB | 2723352..2724398 (-) | 1047 | WP_002369171.1 | competence type IV pilus assembly protein ComGB | - |
| ACK2JZ_RS13105 | comGA | 2724355..2725323 (-) | 969 | WP_002364362.1 | competence type IV pilus ATPase ComGA | - |
| ACK2JZ_RS13110 | - | 2725564..2726892 (-) | 1329 | WP_002362058.1 | APC family permease | - |
| ACK2JZ_RS13115 | rlmN | 2727182..2728255 (-) | 1074 | WP_002356987.1 | 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN | - |
| ACK2JZ_RS13120 | - | 2728380..2730209 (-) | 1830 | WP_002393620.1 | ABC transporter permease | - |
| ACK2JZ_RS13125 | - | 2730199..2730948 (-) | 750 | WP_002381711.1 | ABC transporter ATP-binding protein | - |
| ACK2JZ_RS13130 | - | 2731066..2731767 (-) | 702 | WP_002364244.1 | GntR family transcriptional regulator | - |
| ACK2JZ_RS13135 | - | 2731898..2734321 (-) | 2424 | WP_002380448.1 | DNA translocase FtsK | - |
| ACK2JZ_RS13140 | - | 2734635..2735846 (-) | 1212 | WP_002380449.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| ACK2JZ_RS13145 | - | 2735875..2736780 (-) | 906 | WP_002360016.1 | prenyltransferase | - |
| ACK2JZ_RS13150 | - | 2736902..2737882 (+) | 981 | WP_002360015.1 | polyprenyl synthetase family protein | - |
| ACK2JZ_RS13155 | cydC | 2737962..2739728 (-) | 1767 | WP_002381710.1 | thiol reductant ABC exporter subunit CydC | - |
| ACK2JZ_RS13160 | cydD | 2739725..2741458 (-) | 1734 | WP_065536070.1 | thiol reductant ABC exporter subunit CydD | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10465.36 Da Isoelectric Point: 7.0118
>NTDB_id=1081588 ACK2JZ_RS13095 WP_002380445.1 2723077..2723352(-) (comGC/cglC) [Enterococcus faecalis strain SFAD86]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDEKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDEKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=1081588 ACK2JZ_RS13095 WP_002380445.1 2723077..2723352(-) (comGC/cglC) [Enterococcus faecalis strain SFAD86]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATGAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATGAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
56.977 |
94.505 |
0.538 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus suis isolate S10 |
51.163 |
94.505 |
0.484 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
45.055 |
100 |
0.451 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
47.297 |
81.319 |
0.385 |