Detailed information NTG1080864

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: ACKZ7T_RS08140
• Genome accession: NZ_CP176564
• Coordinates: 1659525..1659836 (-)
• Length: 103 a.a.
• NCBI ID: WP_000472256.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain V0641
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1654525..1664836

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACKZ7T_RS08105 (ACKZ7T_08105)	gcvPA	1655027..1656373 (-)	1347	WP_250414104.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-
ACKZ7T_RS08110 (ACKZ7T_08110)	gcvT	1656393..1657484 (-)	1092	WP_409481309.1	glycine cleavage system aminomethyltransferase GcvT	-
ACKZ7T_RS08115 (ACKZ7T_08115)	-	1657643..1658167 (-)	525	WP_115211241.1	shikimate kinase	-
ACKZ7T_RS08120 (ACKZ7T_08120)	-	1658157..1658303 (-)	147	WP_001789879.1	hypothetical protein	-
ACKZ7T_RS08125 (ACKZ7T_08125)	comGF	1658400..1658897 (-)	498	WP_115211242.1	competence type IV pilus minor pilin ComGF	Machinery gene
ACKZ7T_RS08130 (ACKZ7T_08130)	comGE	1658815..1659114 (-)	300	WP_409481310.1	competence protein ComGE	Machinery gene
ACKZ7T_RS08135 (ACKZ7T_08135)	comGD	1659101..1659547 (-)	447	WP_409481311.1	competence type IV pilus minor pilin ComGD	Machinery gene
ACKZ7T_RS08140 (ACKZ7T_08140)	comGC	1659525..1659836 (-)	312	WP_000472256.1	competence type IV pilus major pilin ComGC	Machinery gene
ACKZ7T_RS08145 (ACKZ7T_08145)	comGB	1659850..1660920 (-)	1071	WP_409481312.1	competence type IV pilus assembly protein ComGB	Machinery gene
ACKZ7T_RS08150 (ACKZ7T_08150)	comGA	1660892..1661866 (-)	975	WP_000697220.1	competence type IV pilus ATPase ComGA	Machinery gene
ACKZ7T_RS08155 (ACKZ7T_08155)	-	1661919..1662542 (-)	624	WP_001223008.1	MBL fold metallo-hydrolase	-
ACKZ7T_RS08160 (ACKZ7T_08160)	-	1662539..1662868 (-)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
ACKZ7T_RS08165 (ACKZ7T_08165)	-	1662868..1663854 (-)	987	WP_000161315.1	ROK family glucokinase	-
ACKZ7T_RS08170 (ACKZ7T_08170)	-	1663851..1664054 (-)	204	WP_000087561.1	YqgQ family protein	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11315.36 Da
• Isoelectric Point: 8.5268

>NTDB_id=1080864 ACKZ7T_RS08140 WP_000472256.1 1659525..1659836(-) (comGC) [Staphylococcus aureus strain V0641]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIADGFI
KEAQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=1080864 ACKZ7T_RS08140 WP_000472256.1 1659525..1659836(-) (comGC) [Staphylococcus aureus strain V0641]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGATGGTTTTATA
AAAGAAGCACAAAAGACATGTAAATCAGGTGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	100	100	1
comGC	Staphylococcus aureus N315	100	100	1
comGC/cglC	Streptococcus pneumoniae TIGR4	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae Rx1	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae D39	46.078	99.029	0.456
comGC/cglC	Streptococcus pneumoniae R6	46.078	99.029	0.456
comGC/cglC	Streptococcus mitis SK321	51.163	83.495	0.427
comGC/cglC	Streptococcus mitis NCTC 12261	51.163	83.495	0.427
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	88.35	0.369
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369