Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | ACK2T8_RS12525 | Genome accession | NZ_CP176513 |
| Coordinates | 2439282..2439686 (-) | Length | 134 a.a. |
| NCBI ID | WP_036658655.1 | Uniprot ID | - |
| Organism | Paenibacillus larvae subsp. larvae strain B-3650 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2405319..2447784 | 2439282..2439686 | within | 0 |
Gene organization within MGE regions
Location: 2405319..2447784
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACK2T8_RS12270 | - | 2405319..2405870 (+) | 552 | WP_036653975.1 | DUF4352 domain-containing protein | - |
| ACK2T8_RS12275 | - | 2406081..2406239 (-) | 159 | WP_077584891.1 | putative holin-like toxin | - |
| ACK2T8_RS12280 | - | 2406340..2406798 (-) | 459 | WP_040931299.1 | helix-turn-helix domain-containing protein | - |
| ACK2T8_RS12285 | - | 2407036..2407221 (+) | 186 | WP_036653970.1 | hypothetical protein | - |
| ACK2T8_RS12290 | - | 2407307..2407570 (+) | 264 | WP_036653966.1 | hypothetical protein | - |
| ACK2T8_RS12295 | - | 2407882..2410800 (-) | 2919 | WP_357683092.1 | RICIN domain-containing protein | - |
| ACK2T8_RS12305 | - | 2412828..2413208 (-) | 381 | WP_309556067.1 | hypothetical protein | - |
| ACK2T8_RS12310 | - | 2413223..2413609 (-) | 387 | WP_309556066.1 | hypothetical protein | - |
| ACK2T8_RS12315 | - | 2413629..2414042 (-) | 414 | WP_309556065.1 | hypothetical protein | - |
| ACK2T8_RS12320 | - | 2414091..2414597 (-) | 507 | WP_309556064.1 | hypothetical protein | - |
| ACK2T8_RS12325 | - | 2414784..2415038 (-) | 255 | WP_051428122.1 | hypothetical protein | - |
| ACK2T8_RS12330 | - | 2415500..2415997 (-) | 498 | Protein_2400 | N-acetylmuramoyl-L-alanine amidase family protein | - |
| ACK2T8_RS12335 | - | 2415997..2416236 (-) | 240 | WP_036656495.1 | BhlA/UviB family holin-like peptide | - |
| ACK2T8_RS12340 | - | 2416217..2416378 (-) | 162 | WP_268568332.1 | hypothetical protein | - |
| ACK2T8_RS12345 | - | 2416375..2416713 (-) | 339 | WP_268568333.1 | hypothetical protein | - |
| ACK2T8_RS12350 | - | 2416723..2417796 (-) | 1074 | WP_275038512.1 | hypothetical protein | - |
| ACK2T8_RS12355 | - | 2417802..2418920 (-) | 1119 | WP_309556063.1 | siphovirus ReqiPepy6 Gp37-like family protein | - |
| ACK2T8_RS12360 | - | 2418923..2419774 (-) | 852 | WP_268568335.1 | phage tail family protein | - |
| ACK2T8_RS12365 | - | 2419771..2422407 (-) | 2637 | WP_268568336.1 | phage tail tape measure protein | - |
| ACK2T8_RS12370 | - | 2422464..2422718 (-) | 255 | WP_268568337.1 | hypothetical protein | - |
| ACK2T8_RS12375 | - | 2422745..2423083 (-) | 339 | WP_268568338.1 | hypothetical protein | - |
| ACK2T8_RS12380 | - | 2423083..2423514 (-) | 432 | WP_313781392.1 | phage major tail protein, TP901-1 family | - |
| ACK2T8_RS12385 | - | 2423517..2423912 (-) | 396 | WP_268568340.1 | DUF3168 domain-containing protein | - |
| ACK2T8_RS12390 | - | 2423896..2424324 (-) | 429 | WP_268568341.1 | hypothetical protein | - |
| ACK2T8_RS12395 | - | 2424324..2424641 (-) | 318 | WP_158672721.1 | phage head closure protein | - |
| ACK2T8_RS12400 | - | 2424619..2424915 (-) | 297 | WP_268568342.1 | head-tail connector protein | - |
| ACK2T8_RS12405 | - | 2424917..2426101 (-) | 1185 | WP_158672719.1 | phage major capsid protein | - |
| ACK2T8_RS12410 | - | 2426113..2426715 (-) | 603 | WP_077996844.1 | HK97 family phage prohead protease | - |
| ACK2T8_RS12415 | - | 2426651..2427910 (-) | 1260 | WP_268568343.1 | phage portal protein | - |
| ACK2T8_RS12420 | - | 2427929..2429644 (-) | 1716 | WP_409475286.1 | terminase large subunit | - |
| ACK2T8_RS12425 | - | 2429631..2429936 (-) | 306 | WP_409475287.1 | phage terminase small subunit P27 family | - |
| ACK2T8_RS12430 | - | 2430075..2430416 (-) | 342 | WP_036658631.1 | HNH endonuclease | - |
| ACK2T8_RS12435 | - | 2430403..2430717 (-) | 315 | WP_023484126.1 | hypothetical protein | - |
| ACK2T8_RS12440 | - | 2430897..2431100 (+) | 204 | WP_036658634.1 | type II toxin-antitoxin system HicA family toxin | - |
| ACK2T8_RS12445 | - | 2431131..2431547 (+) | 417 | WP_023484796.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| ACK2T8_RS12450 | - | 2431602..2431946 (-) | 345 | WP_036658635.1 | YxeA family protein | - |
| ACK2T8_RS12455 | - | 2432048..2433271 (-) | 1224 | WP_024093891.1 | IS256 family transposase | - |
| ACK2T8_RS12460 | - | 2433536..2433976 (-) | 441 | WP_036658716.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| ACK2T8_RS12465 | - | 2434102..2434245 (-) | 144 | WP_155116353.1 | hypothetical protein | - |
| ACK2T8_RS12470 | - | 2434242..2434487 (-) | 246 | WP_036658638.1 | hypothetical protein | - |
| ACK2T8_RS12475 | - | 2434480..2434713 (-) | 234 | WP_036658640.1 | hypothetical protein | - |
| ACK2T8_RS12480 | - | 2434765..2434947 (-) | 183 | WP_036658642.1 | hypothetical protein | - |
| ACK2T8_RS12485 | - | 2434931..2435713 (-) | 783 | WP_023483250.1 | DNA cytosine methyltransferase | - |
| ACK2T8_RS12490 | - | 2435730..2436035 (-) | 306 | WP_309556053.1 | hypothetical protein | - |
| ACK2T8_RS12495 | - | 2436277..2436651 (-) | 375 | WP_036658646.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ACK2T8_RS12500 | - | 2436644..2436862 (-) | 219 | WP_036658649.1 | hypothetical protein | - |
| ACK2T8_RS12505 | - | 2436981..2437802 (-) | 822 | WP_077584884.1 | ATP-binding protein | - |
| ACK2T8_RS12510 | - | 2437693..2438475 (-) | 783 | WP_023483153.1 | DnaD domain-containing protein | - |
| ACK2T8_RS12515 | - | 2438555..2438887 (-) | 333 | WP_036658651.1 | hypothetical protein | - |
| ACK2T8_RS12520 | - | 2438884..2439273 (-) | 390 | WP_036658652.1 | hypothetical protein | - |
| ACK2T8_RS12525 | ssbA | 2439282..2439686 (-) | 405 | WP_036658655.1 | single-stranded DNA-binding protein | Machinery gene |
| ACK2T8_RS12530 | - | 2439676..2440314 (-) | 639 | WP_023485215.1 | ERF family protein | - |
| ACK2T8_RS12535 | - | 2440317..2440865 (-) | 549 | WP_023485214.1 | host-nuclease inhibitor Gam family protein | - |
| ACK2T8_RS12540 | - | 2440862..2441125 (-) | 264 | WP_036658656.1 | hypothetical protein | - |
| ACK2T8_RS12545 | - | 2441225..2441365 (-) | 141 | WP_155116354.1 | hypothetical protein | - |
| ACK2T8_RS12550 | - | 2441343..2441687 (-) | 345 | WP_036658659.1 | hypothetical protein | - |
| ACK2T8_RS12555 | - | 2441774..2442286 (+) | 513 | WP_036658661.1 | hypothetical protein | - |
| ACK2T8_RS12560 | - | 2442276..2442533 (-) | 258 | WP_036658663.1 | hypothetical protein | - |
| ACK2T8_RS12565 | - | 2442526..2443101 (-) | 576 | WP_036658665.1 | hypothetical protein | - |
| ACK2T8_RS12570 | - | 2443098..2443850 (-) | 753 | WP_023483806.1 | phage antirepressor KilAC domain-containing protein | - |
| ACK2T8_RS12575 | - | 2443855..2444028 (-) | 174 | WP_155116304.1 | hypothetical protein | - |
| ACK2T8_RS12580 | - | 2444012..2444242 (-) | 231 | WP_036658666.1 | hypothetical protein | - |
| ACK2T8_RS12585 | - | 2444239..2444616 (-) | 378 | WP_036658668.1 | hypothetical protein | - |
| ACK2T8_RS12590 | - | 2444623..2444826 (-) | 204 | WP_036658670.1 | hypothetical protein | - |
| ACK2T8_RS12595 | - | 2444847..2445116 (-) | 270 | WP_036658672.1 | hypothetical protein | - |
| ACK2T8_RS12600 | - | 2445131..2445322 (-) | 192 | WP_144029586.1 | hypothetical protein | - |
| ACK2T8_RS12605 | - | 2445445..2445717 (-) | 273 | WP_311795378.1 | helix-turn-helix transcriptional regulator | - |
| ACK2T8_RS12610 | - | 2445762..2446100 (+) | 339 | WP_036658676.1 | helix-turn-helix domain-containing protein | - |
| ACK2T8_RS12615 | - | 2446102..2447784 (+) | 1683 | WP_023484366.1 | recombinase family protein | - |
Sequence
Protein
Download Length: 134 a.a. Molecular weight: 15606.49 Da Isoelectric Point: 5.9505
>NTDB_id=1080528 ACK2T8_RS12525 WP_036658655.1 2439282..2439686(-) (ssbA) [Paenibacillus larvae subsp. larvae strain B-3650]
MLNRVVLIGRLTRDPELRYTPSGVAVTKFTLAVDRPYMNQQTRERETDFINIVTWRQTAEACANHLRKGRLTAVEGRIQV
RNYENNEGRRIYVTEVVADNVRFLESSKNENKRPEDPFYDSSTPLDISDDELPF
MLNRVVLIGRLTRDPELRYTPSGVAVTKFTLAVDRPYMNQQTRERETDFINIVTWRQTAEACANHLRKGRLTAVEGRIQV
RNYENNEGRRIYVTEVVADNVRFLESSKNENKRPEDPFYDSSTPLDISDDELPF
Nucleotide
Download Length: 405 bp
>NTDB_id=1080528 ACK2T8_RS12525 WP_036658655.1 2439282..2439686(-) (ssbA) [Paenibacillus larvae subsp. larvae strain B-3650]
ATGCTGAATAGGGTTGTTTTAATCGGCAGACTGACGAGAGATCCGGAATTAAGATATACTCCATCCGGTGTAGCTGTCAC
CAAGTTTACCCTGGCGGTAGACCGTCCGTATATGAACCAGCAAACGCGTGAGCGAGAGACGGATTTCATTAATATCGTGA
CGTGGAGACAAACCGCGGAAGCCTGTGCCAATCACCTTCGCAAAGGCCGTTTGACGGCAGTAGAAGGAAGAATCCAGGTG
CGTAATTATGAGAACAATGAGGGCCGCAGAATCTATGTAACCGAGGTTGTGGCTGATAATGTGCGCTTTCTTGAATCAAG
TAAAAATGAAAATAAACGCCCTGAAGACCCTTTCTACGACTCTAGCACACCACTAGACATTTCAGATGATGAACTCCCCT
TCTAG
ATGCTGAATAGGGTTGTTTTAATCGGCAGACTGACGAGAGATCCGGAATTAAGATATACTCCATCCGGTGTAGCTGTCAC
CAAGTTTACCCTGGCGGTAGACCGTCCGTATATGAACCAGCAAACGCGTGAGCGAGAGACGGATTTCATTAATATCGTGA
CGTGGAGACAAACCGCGGAAGCCTGTGCCAATCACCTTCGCAAAGGCCGTTTGACGGCAGTAGAAGGAAGAATCCAGGTG
CGTAATTATGAGAACAATGAGGGCCGCAGAATCTATGTAACCGAGGTTGTGGCTGATAATGTGCGCTTTCTTGAATCAAG
TAAAAATGAAAATAAACGCCCTGAAGACCCTTTCTACGACTCTAGCACACCACTAGACATTTCAGATGATGAACTCCCCT
TCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
47.977 |
100 |
0.619 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
45.029 |
100 |
0.575 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
54.286 |
78.358 |
0.425 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
41.791 |
100 |
0.418 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
41.045 |
100 |
0.41 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
40.299 |
100 |
0.403 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
40.299 |
100 |
0.403 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
40.299 |
100 |
0.403 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
40.299 |
100 |
0.403 |
| ssbB/cilA | Streptococcus mitis SK321 |
40.299 |
100 |
0.403 |
| ssb | Neisseria gonorrhoeae MS11 |
41.6 |
93.284 |
0.388 |
| ssbA | Streptococcus mutans UA159 |
38.06 |
100 |
0.381 |