Detailed information NTG1058550

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: ACFDBC_RS06280
• Genome accession: NZ_CP170659
• Coordinates: 1298369..1298686 (+)
• Length: 105 a.a.
• NCBI ID: WP_002446532.1
• Uniprot ID: -
• Organism: Staphylococcus epidermidis strain CCARM 3A600
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1293369..1303686

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACFDBC_RS06250 (ACFDBC_06250)	-	1294145..1294345 (+)	201	WP_002446537.1	YqgQ family protein	-
ACFDBC_RS06255 (ACFDBC_06255)	-	1294345..1295331 (+)	987	WP_002446536.1	ROK family glucokinase	-
ACFDBC_RS06260 (ACFDBC_06260)	-	1295331..1295657 (+)	327	WP_001831234.1	MTH1187 family thiamine-binding protein	-
ACFDBC_RS06265 (ACFDBC_06265)	-	1295657..1296280 (+)	624	WP_002446535.1	MBL fold metallo-hydrolase	-
ACFDBC_RS06270 (ACFDBC_06270)	comGA	1296337..1297311 (+)	975	WP_002446534.1	competence type IV pilus ATPase ComGA	Machinery gene
ACFDBC_RS06275 (ACFDBC_06275)	comGB	1297283..1298351 (+)	1069	Protein_1197	competence type IV pilus assembly protein ComGB	-
ACFDBC_RS06280 (ACFDBC_06280)	comGC	1298369..1298686 (+)	318	WP_002446532.1	competence type IV pilus major pilin ComGC	Machinery gene
ACFDBC_RS06285 (ACFDBC_06285)	comGD	1298676..1299113 (+)	438	WP_002446531.1	competence type IV pilus minor pilin ComGD	-
ACFDBC_RS06290 (ACFDBC_06290)	-	1299100..1299393 (+)	294	WP_002446530.1	hypothetical protein	-
ACFDBC_RS06295 (ACFDBC_06295)	-	1299317..1299808 (+)	492	WP_002457724.1	competence type IV pilus minor pilin ComGF	-
ACFDBC_RS06300 (ACFDBC_06300)	-	1299973..1300485 (+)	513	WP_002457723.1	shikimate kinase	-
ACFDBC_RS06305 (ACFDBC_06305)	gcvT	1300703..1301794 (+)	1092	WP_002457722.1	glycine cleavage system aminomethyltransferase GcvT	-
ACFDBC_RS06310 (ACFDBC_06310)	gcvPA	1301814..1303160 (+)	1347	WP_002446526.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 105 a.a.
• Molecular weight: 11491.53 Da
• Isoelectric Point: 9.2160

>NTDB_id=1058550 ACFDBC_RS06280 WP_002446532.1 1298369..1298686(+) (comGC) [Staphylococcus epidermidis strain CCARM 3A600]
MKTLKLLKQTRAFTLIEMLLVLLIISLLLILIIPNIAKQTSHIQSTGCDAQVKMVNSQIEAYALKHNRNPSNIDDLVSDG
FIKEGQKTCKSGQTISIANGEAVAN

Nucleotide

• Length: 318 bp

>NTDB_id=1058550 ACFDBC_RS06280 WP_002446532.1 1298369..1298686(+) (comGC) [Staphylococcus epidermidis strain CCARM 3A600]
ATGAAAACATTGAAATTATTGAAACAAACACGAGCATTTACCTTGATAGAAATGCTTTTAGTATTACTAATAATCAGTTT
ATTATTAATACTTATAATTCCAAATATTGCAAAACAAACATCTCATATTCAGTCAACTGGATGTGATGCTCAAGTTAAAA
TGGTAAACAGTCAAATAGAAGCCTACGCTTTAAAACATAACCGCAACCCTTCTAATATTGATGATTTGGTTTCAGATGGT
TTTATAAAAGAAGGACAAAAAACATGTAAATCCGGTCAGACAATTAGTATTGCAAATGGAGAGGCAGTTGCCAATTAA

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (9-32)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	86.275	97.143	0.838
comGC	Staphylococcus aureus N315	86.275	97.143	0.838
comGC/cglC	Streptococcus mitis SK321	43.689	98.095	0.429
comGC/cglC	Streptococcus pneumoniae R6	43.617	89.524	0.39
comGC/cglC	Streptococcus pneumoniae TIGR4	43.617	89.524	0.39
comGC/cglC	Streptococcus pneumoniae Rx1	43.617	89.524	0.39
comGC/cglC	Streptococcus pneumoniae D39	43.617	89.524	0.39
comYC	Streptococcus mutans UA159	47.674	81.905	0.39
comYC	Streptococcus suis isolate S10	47.674	81.905	0.39
comYC	Streptococcus mutans UA140	47.674	81.905	0.39
comYC	Streptococcus gordonii str. Challis substr. CH1	46.512	81.905	0.381
comGC/cglC	Streptococcus mitis NCTC 12261	50	72.381	0.362
comGC	Bacillus subtilis subsp. subtilis str. 168	41.758	86.667	0.362
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	78.095	0.362