Detailed information NTG1056563

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: ACFIOH_RS06115
• Genome accession: NZ_CP170389
• Coordinates: 1191973..1192284 (+)
• Length: 103 a.a.
• NCBI ID: WP_054190026.1
• Uniprot ID: -
• Organism: Staphylococcus aureus strain t14667
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1186973..1197284

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACFIOH_RS06085	-	1187756..1187959 (+)	204	WP_000087561.1	YqgQ family protein	-
ACFIOH_RS06090	-	1187956..1188942 (+)	987	WP_000161315.1	ROK family glucokinase	-
ACFIOH_RS06095	-	1188942..1189271 (+)	330	WP_001018871.1	MTH1187 family thiamine-binding protein	-
ACFIOH_RS06100	-	1189268..1189891 (+)	624	WP_054190028.1	MBL fold metallo-hydrolase	-
ACFIOH_RS06105	comGA	1189943..1190917 (+)	975	WP_054191886.1	competence type IV pilus ATPase ComGA	Machinery gene
ACFIOH_RS06110	comGB	1190889..1191959 (+)	1071	WP_054190027.1	competence type IV pilus assembly protein ComGB	Machinery gene
ACFIOH_RS06115	comGC	1191973..1192284 (+)	312	WP_054190026.1	competence type IV pilus major pilin ComGC	Machinery gene
ACFIOH_RS06120	comGD	1192262..1192708 (+)	447	WP_077446655.1	competence type IV pilus minor pilin ComGD	Machinery gene
ACFIOH_RS06125	comGE	1192695..1192994 (+)	300	WP_054190024.1	hypothetical protein	Machinery gene
ACFIOH_RS06130	comGF	1192912..1193409 (+)	498	WP_077446653.1	competence type IV pilus minor pilin ComGF	Machinery gene
ACFIOH_RS06135	-	1193506..1193652 (+)	147	WP_001789879.1	hypothetical protein	-
ACFIOH_RS06140	-	1193642..1194166 (+)	525	WP_054190023.1	shikimate kinase	-
ACFIOH_RS06145	gcvT	1194325..1195416 (+)	1092	WP_054190022.1	glycine cleavage system aminomethyltransferase GcvT	-
ACFIOH_RS06150	gcvPA	1195436..1196782 (+)	1347	WP_054190021.1	aminomethyl-transferring glycine dehydrogenase subunit GcvPA	-

Sequence

Protein

• Length: 103 a.a.
• Molecular weight: 11329.38 Da
• Isoelectric Point: 8.5268

>NTDB_id=1056563 ACFIOH_RS06115 WP_054190026.1 1191973..1192284(+) (comGC) [Staphylococcus aureus strain t14667]
MFKFLKKTQAFTLIEMLLVLLIISLLLILIIPNIAKQTAHIQSTGCNAQVKMVNSQIEAYALKHNRNPSSIEDLIAEGFI
KEAQKTCKSGETITISNGEAVAN

Nucleotide

• Length: 312 bp

>NTDB_id=1056563 ACFIOH_RS06115 WP_054190026.1 1191973..1192284(+) (comGC) [Staphylococcus aureus strain t14667]
ATGTTTAAATTTCTTAAGAAAACTCAAGCGTTTACATTGATAGAGATGCTATTAGTGTTATTAATCATCAGTTTATTATT
AATTTTAATCATTCCAAATATTGCTAAACAAACTGCTCACATACAATCAACAGGTTGTAATGCACAGGTAAAAATGGTTA
ATAGTCAAATTGAAGCGTATGCATTGAAACATAATAGAAATCCATCGTCTATTGAAGACTTAATTGCAGAGGGTTTCATA
AAAGAAGCACAAAAGACATGTAAATCAGGAGAGACAATAACAATTAGTAATGGAGAAGCAGTTGCAAATTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (6-30)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Staphylococcus aureus MW2	99.029	100	0.99
comGC	Staphylococcus aureus N315	99.029	100	0.99
comGC/cglC	Streptococcus pneumoniae TIGR4	45.098	99.029	0.447
comGC/cglC	Streptococcus pneumoniae Rx1	45.098	99.029	0.447
comGC/cglC	Streptococcus pneumoniae D39	45.098	99.029	0.447
comGC/cglC	Streptococcus pneumoniae R6	45.098	99.029	0.447
comGC/cglC	Streptococcus mitis SK321	50	83.495	0.417
comGC/cglC	Streptococcus mitis NCTC 12261	50	83.495	0.417
comYC	Streptococcus gordonii str. Challis substr. CH1	42.857	95.146	0.408
comYC	Streptococcus suis isolate S10	50	75.728	0.379
comGC	Bacillus subtilis subsp. subtilis str. 168	42.857	88.35	0.379
comGC	Lactococcus lactis subsp. cremoris KW2	46.341	79.612	0.369