Detailed information NTG1050458

Bioinformatically predicted

Overview

• Name: comGC
• Type: Machinery gene
• Locus tag: ACEY2B_RS00875
• Genome accession: NZ_CP169315
• Coordinates: 179291..179674 (+)
• Length: 127 a.a.
• NCBI ID: WP_015427166.1
• Uniprot ID: -
• Organism: Lactococcus lactis strain IFLLLBEK1
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 174291..184674

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
ACEY2B_RS00860 (ACEY2B_00860)	-	176146..177102 (+)	957	WP_052312061.1	hypothetical protein	-
ACEY2B_RS00865 (ACEY2B_00865)	comGA	177372..178310 (+)	939	WP_015427168.1	competence type IV pilus ATPase ComGA	Machinery gene
ACEY2B_RS00870 (ACEY2B_00870)	comGB	178204..179277 (+)	1074	WP_080619357.1	competence type IV pilus assembly protein ComGB	Machinery gene
ACEY2B_RS00875 (ACEY2B_00875)	comGC	179291..179674 (+)	384	WP_015427166.1	competence type IV pilus major pilin ComGC	Machinery gene
ACEY2B_RS00880 (ACEY2B_00880)	comGD	179634..180065 (+)	432	WP_015427165.1	competence type IV pilus minor pilin ComGD	Machinery gene
ACEY2B_RS00885 (ACEY2B_00885)	comGE	180037..180333 (+)	297	WP_015427164.1	competence type IV pilus minor pilin ComGE	Machinery gene
ACEY2B_RS00890 (ACEY2B_00890)	comGF	180296..180742 (+)	447	WP_042230641.1	competence type IV pilus minor pilin ComGF	Machinery gene
ACEY2B_RS00895 (ACEY2B_00895)	comGG	180790..181065 (+)	276	WP_374788292.1	hypothetical protein	Machinery gene
ACEY2B_RS00900 (ACEY2B_00900)	-	181147..181584 (+)	438	WP_136122555.1	zinc-dependent MarR family transcriptional regulator	-
ACEY2B_RS00905 (ACEY2B_00905)	-	181581..182423 (+)	843	WP_015427160.1	metal ABC transporter substrate-binding protein	-
ACEY2B_RS00910 (ACEY2B_00910)	-	182600..183337 (+)	738	WP_015427159.1	metal ABC transporter ATP-binding protein	-
ACEY2B_RS00915 (ACEY2B_00915)	-	183330..184139 (+)	810	WP_015427158.1	metal ABC transporter permease	-

Sequence

Protein

• Length: 127 a.a.
• Molecular weight: 14898.48 Da
• Isoelectric Point: 8.7864

>NTDB_id=1050458 ACEY2B_RS00875 WP_015427166.1 179291..179674(+) (comGC) [Lactococcus lactis strain IFLLLBEK1]
MERTKKFILKKIQKIFLFVKICEKKYRQKELKAFTLIEMLIVLAIISILILLFVPNLIKEKSQVQKTGEAAVVKVVENQA
QLYELDHDDEKPTLSELLSAGMITQKQISAYDNYYDQNKNEERNFND

Nucleotide

• Length: 384 bp

>NTDB_id=1050458 ACEY2B_RS00875 WP_015427166.1 179291..179674(+) (comGC) [Lactococcus lactis strain IFLLLBEK1]
ATGGAAAGAACAAAGAAGTTTATTTTAAAGAAAATACAAAAAATATTTTTATTCGTTAAAATTTGTGAAAAAAAATACCG
TCAGAAAGAGCTAAAAGCTTTTACTTTGATAGAGATGTTAATTGTACTAGCTATTATTAGTATTTTGATATTACTATTTG
TTCCAAATTTAATTAAAGAAAAATCACAAGTTCAAAAAACTGGAGAAGCGGCAGTTGTGAAAGTAGTAGAAAATCAAGCC
CAACTTTATGAATTAGATCATGATGATGAGAAGCCGACTCTGTCAGAATTGCTCAGCGCTGGGATGATTACTCAAAAACA
AATTTCTGCTTACGATAATTACTATGATCAGAATAAAAATGAAGAACGAAATTTTAATGACTAG

Domains

Predicted by InterproScan.

• Prokaryotic N-terminal methylation motif (N_methyl) (32-52)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGC	Lactococcus lactis subsp. cremoris KW2	80.172	91.339	0.732
comYC	Streptococcus mutans UA159	55.446	79.528	0.441
comYC	Streptococcus mutans UA140	55.446	79.528	0.441
comYC	Streptococcus gordonii str. Challis substr. CH1	56.566	77.953	0.441
comGC/cglC	Streptococcus mitis SK321	54.455	79.528	0.433
comGC/cglC	Streptococcus pneumoniae TIGR4	52.475	79.528	0.417
comGC/cglC	Streptococcus pneumoniae Rx1	52.475	79.528	0.417
comGC/cglC	Streptococcus pneumoniae D39	52.475	79.528	0.417
comGC/cglC	Streptococcus pneumoniae R6	52.475	79.528	0.417
comGC/cglC	Streptococcus mitis NCTC 12261	56.18	70.079	0.394
comYC	Streptococcus suis isolate S10	56.818	69.291	0.394