Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | ACD268_RS10315 | Genome accession | NZ_CP168299 |
| Coordinates | 1991729..1992145 (-) | Length | 138 a.a. |
| NCBI ID | WP_000609559.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain FC1 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1961219..2008954 | 1991729..1992145 | within | 0 |
Gene organization within MGE regions
Location: 1961219..2008954
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ACD268_RS10100 (ACD268_10100) | lytA | 1961219..1962175 (-) | 957 | WP_373381835.1 | N-acetylmuramoyl-L-alanine amidase LytA | - |
| ACD268_RS10105 (ACD268_10105) | - | 1962179..1962511 (-) | 333 | WP_001186206.1 | phage holin | - |
| ACD268_RS10110 (ACD268_10110) | - | 1962515..1962931 (-) | 417 | WP_001165344.1 | phage holin family protein | - |
| ACD268_RS10115 (ACD268_10115) | - | 1962941..1963291 (-) | 351 | WP_000852249.1 | hypothetical protein | - |
| ACD268_RS10120 (ACD268_10120) | - | 1963294..1963497 (-) | 204 | WP_001091107.1 | hypothetical protein | - |
| ACD268_RS10125 (ACD268_10125) | - | 1963478..1963594 (-) | 117 | Protein_1970 | dihydrodipicolinate reductase | - |
| ACD268_RS10130 (ACD268_10130) | - | 1963591..1970880 (-) | 7290 | WP_373381836.1 | tail fiber domain-containing protein | - |
| ACD268_RS10135 (ACD268_10135) | - | 1970885..1971235 (-) | 351 | WP_000068025.1 | DUF6711 family protein | - |
| ACD268_RS10140 (ACD268_10140) | - | 1971244..1974897 (-) | 3654 | WP_373381837.1 | hypothetical protein | - |
| ACD268_RS10145 (ACD268_10145) | - | 1974884..1975234 (-) | 351 | WP_000478016.1 | hypothetical protein | - |
| ACD268_RS10150 (ACD268_10150) | - | 1975273..1975653 (-) | 381 | WP_001185634.1 | DUF6096 family protein | - |
| ACD268_RS10155 (ACD268_10155) | - | 1975658..1976071 (-) | 414 | WP_000880674.1 | phage tail tube protein | - |
| ACD268_RS10160 (ACD268_10160) | - | 1976074..1976442 (-) | 369 | WP_000608235.1 | hypothetical protein | - |
| ACD268_RS10165 (ACD268_10165) | - | 1976439..1976954 (-) | 516 | WP_000015941.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| ACD268_RS10170 (ACD268_10170) | - | 1976929..1977267 (-) | 339 | WP_050125325.1 | hypothetical protein | - |
| ACD268_RS10175 (ACD268_10175) | - | 1977248..1977559 (-) | 312 | WP_050110663.1 | phage head-tail connector protein | - |
| ACD268_RS10180 (ACD268_10180) | - | 1977561..1977749 (-) | 189 | WP_000669348.1 | hypothetical protein | - |
| ACD268_RS10185 (ACD268_10185) | - | 1977739..1977921 (-) | 183 | WP_000054934.1 | Rho termination factor N-terminal domain-containing protein | - |
| ACD268_RS10190 (ACD268_10190) | - | 1977933..1978778 (-) | 846 | WP_000123890.1 | N4-gp56 family major capsid protein | - |
| ACD268_RS10195 (ACD268_10195) | - | 1978785..1979360 (-) | 576 | WP_050116223.1 | DUF4355 domain-containing protein | - |
| ACD268_RS10200 (ACD268_10200) | - | 1979528..1979779 (-) | 252 | WP_050391397.1 | DUF6275 family protein | - |
| ACD268_RS10205 (ACD268_10205) | - | 1979781..1980026 (-) | 246 | WP_000877357.1 | hypothetical protein | - |
| ACD268_RS10210 (ACD268_10210) | - | 1980069..1980482 (-) | 414 | WP_000565276.1 | HD domain-containing protein | - |
| ACD268_RS10215 (ACD268_10215) | - | 1980479..1980688 (-) | 210 | WP_000651747.1 | hypothetical protein | - |
| ACD268_RS10220 (ACD268_10220) | - | 1980690..1982327 (-) | 1638 | WP_180681607.1 | minor capsid protein | - |
| ACD268_RS10225 (ACD268_10225) | - | 1982236..1983705 (-) | 1470 | WP_373381838.1 | phage portal protein | - |
| ACD268_RS10230 (ACD268_10230) | - | 1983717..1985015 (-) | 1299 | WP_050294909.1 | PBSX family phage terminase large subunit | - |
| ACD268_RS10235 (ACD268_10235) | - | 1984993..1985433 (-) | 441 | WP_025173333.1 | terminase small subunit | - |
| ACD268_RS10245 (ACD268_10245) | - | 1985901..1986305 (-) | 405 | WP_001030241.1 | DUF1492 domain-containing protein | - |
| ACD268_RS10250 (ACD268_10250) | - | 1986377..1986748 (-) | 372 | WP_050119274.1 | hypothetical protein | - |
| ACD268_RS10255 (ACD268_10255) | - | 1986745..1987182 (-) | 438 | WP_330783782.1 | YopX family protein | - |
| ACD268_RS10260 (ACD268_10260) | - | 1987295..1987753 (-) | 459 | WP_000340952.1 | hypothetical protein | - |
| ACD268_RS10265 (ACD268_10265) | - | 1987753..1988013 (-) | 261 | WP_001252173.1 | DUF1372 family protein | - |
| ACD268_RS10270 (ACD268_10270) | - | 1988015..1988353 (-) | 339 | WP_000119455.1 | hypothetical protein | - |
| ACD268_RS10275 (ACD268_10275) | - | 1988350..1988538 (-) | 189 | WP_001277861.1 | hypothetical protein | - |
| ACD268_RS10280 (ACD268_10280) | - | 1988538..1989212 (-) | 675 | WP_330779091.1 | DUF1642 domain-containing protein | - |
| ACD268_RS10285 (ACD268_10285) | - | 1989214..1989531 (-) | 318 | WP_001862972.1 | hypothetical protein | - |
| ACD268_RS10290 (ACD268_10290) | - | 1989576..1989998 (-) | 423 | WP_000167804.1 | hypothetical protein | - |
| ACD268_RS10295 (ACD268_10295) | - | 1990042..1990470 (-) | 429 | WP_000779142.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ACD268_RS10300 (ACD268_10300) | - | 1990467..1990796 (-) | 330 | WP_138033040.1 | hypothetical protein | - |
| ACD268_RS10305 (ACD268_10305) | - | 1990810..1991019 (-) | 210 | WP_000455269.1 | hypothetical protein | - |
| ACD268_RS10310 (ACD268_10310) | - | 1991021..1991716 (-) | 696 | WP_050099130.1 | site-specific DNA-methyltransferase | - |
| ACD268_RS10315 (ACD268_10315) | ssbA | 1991729..1992145 (-) | 417 | WP_000609559.1 | single-stranded DNA-binding protein | Machinery gene |
| ACD268_RS10320 (ACD268_10320) | - | 1992240..1992575 (-) | 336 | WP_000598346.1 | sporulation protein Cse60 | - |
| ACD268_RS10325 (ACD268_10325) | - | 1992568..1992891 (-) | 324 | WP_373382344.1 | hypothetical protein | - |
| ACD268_RS10330 (ACD268_10330) | - | 1993059..1994099 (-) | 1041 | WP_001157037.1 | DUF1351 domain-containing protein | - |
| ACD268_RS10335 (ACD268_10335) | bet | 1994109..1994873 (-) | 765 | WP_000184008.1 | phage recombination protein Bet | - |
| ACD268_RS10340 (ACD268_10340) | - | 1994885..1995115 (-) | 231 | WP_000192920.1 | hypothetical protein | - |
| ACD268_RS10345 (ACD268_10345) | - | 1995235..1995378 (-) | 144 | WP_000161124.1 | hypothetical protein | - |
| ACD268_RS10350 (ACD268_10350) | - | 1995365..1995625 (-) | 261 | WP_000471465.1 | hypothetical protein | - |
| ACD268_RS10355 (ACD268_10355) | - | 1995638..1995892 (-) | 255 | WP_001866806.1 | hypothetical protein | - |
| ACD268_RS10360 (ACD268_10360) | - | 1995893..1996114 (-) | 222 | WP_001862960.1 | hypothetical protein | - |
| ACD268_RS10365 (ACD268_10365) | - | 1996114..1996275 (-) | 162 | WP_000823399.1 | BOW99_gp33 family protein | - |
| ACD268_RS10370 (ACD268_10370) | - | 1996340..1996483 (-) | 144 | WP_000389589.1 | hypothetical protein | - |
| ACD268_RS10375 (ACD268_10375) | - | 1996601..1996825 (+) | 225 | WP_001862956.1 | hypothetical protein | - |
| ACD268_RS10380 (ACD268_10380) | - | 1997128..1997406 (-) | 279 | WP_000261154.1 | HTH domain-containing protein | - |
| ACD268_RS10385 (ACD268_10385) | - | 1997573..1997809 (-) | 237 | WP_001157069.1 | hypothetical protein | - |
| ACD268_RS10390 (ACD268_10390) | - | 1998001..1998291 (-) | 291 | WP_000167802.1 | hypothetical protein | - |
| ACD268_RS10395 (ACD268_10395) | - | 1998288..1998434 (-) | 147 | WP_000389580.1 | hypothetical protein | - |
| ACD268_RS10400 (ACD268_10400) | - | 1998829..1998951 (-) | 123 | WP_000343850.1 | hypothetical protein | - |
| ACD268_RS10405 (ACD268_10405) | - | 1999025..1999300 (-) | 276 | WP_001094380.1 | hypothetical protein | - |
| ACD268_RS10410 (ACD268_10410) | - | 1999461..2000213 (+) | 753 | WP_001023158.1 | XRE family transcriptional regulator | - |
| ACD268_RS10415 (ACD268_10415) | - | 2000215..2000415 (+) | 201 | WP_000064302.1 | hypothetical protein | - |
| ACD268_RS10420 (ACD268_10420) | - | 2000589..2002034 (+) | 1446 | WP_024478469.1 | recombinase family protein | - |
| ACD268_RS10425 (ACD268_10425) | comGB/cglB | 2002116..2003132 (-) | 1017 | WP_074017570.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| ACD268_RS10430 (ACD268_10430) | comGA/cglA/cilD | 2003080..2004021 (-) | 942 | WP_000249555.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| ACD268_RS10435 (ACD268_10435) | - | 2004096..2004461 (-) | 366 | WP_000286415.1 | DUF1033 family protein | - |
| ACD268_RS10440 (ACD268_10440) | - | 2004612..2005670 (-) | 1059 | WP_000649466.1 | zinc-dependent alcohol dehydrogenase family protein | - |
| ACD268_RS10445 (ACD268_10445) | nagA | 2005833..2006984 (-) | 1152 | WP_001134457.1 | N-acetylglucosamine-6-phosphate deacetylase | - |
| ACD268_RS10450 (ACD268_10450) | - | 2007137..2008954 (-) | 1818 | WP_001220838.1 | acyltransferase family protein | - |
Sequence
Protein
Download Length: 138 a.a. Molecular weight: 15253.01 Da Isoelectric Point: 8.0002
>NTDB_id=1043751 ACD268_RS10315 WP_000609559.1 1991729..1992145(-) (ssbA) [Streptococcus pneumoniae strain FC1]
MINNVTLVGRLVAPPDLRKTPNNVSSLQGTLAVNRNFKNENGEREADFINFKAWRGTADIIAQYCSKGSLIGIIGRLQVR
SYEKDGQRRYVTEVIAESVALLESRNSQHGQGNSFQNGNSSPFTDPNPFDLPNDGLPF
MINNVTLVGRLVAPPDLRKTPNNVSSLQGTLAVNRNFKNENGEREADFINFKAWRGTADIIAQYCSKGSLIGIIGRLQVR
SYEKDGQRRYVTEVIAESVALLESRNSQHGQGNSFQNGNSSPFTDPNPFDLPNDGLPF
Nucleotide
Download Length: 417 bp
>NTDB_id=1043751 ACD268_RS10315 WP_000609559.1 1991729..1992145(-) (ssbA) [Streptococcus pneumoniae strain FC1]
ATGATCAATAACGTCACACTGGTTGGGAGGCTTGTAGCGCCTCCTGATCTACGAAAAACGCCTAACAATGTATCTAGCTT
GCAGGGCACGCTTGCAGTCAATCGCAATTTCAAAAACGAAAATGGAGAGCGTGAGGCTGATTTTATCAATTTTAAAGCTT
GGAGAGGTACAGCTGACATCATTGCTCAGTATTGCAGCAAGGGCTCACTTATTGGGATCATTGGGCGCTTACAAGTTAGG
TCTTACGAGAAAGACGGTCAGCGTCGATATGTGACTGAAGTAATCGCTGAGAGTGTAGCTCTGCTAGAGAGTCGCAACAG
TCAGCACGGACAAGGCAACAGTTTCCAAAATGGGAATAGCTCACCTTTTACCGATCCTAACCCCTTTGACCTCCCAAATG
ACGGTTTGCCGTTTTAG
ATGATCAATAACGTCACACTGGTTGGGAGGCTTGTAGCGCCTCCTGATCTACGAAAAACGCCTAACAATGTATCTAGCTT
GCAGGGCACGCTTGCAGTCAATCGCAATTTCAAAAACGAAAATGGAGAGCGTGAGGCTGATTTTATCAATTTTAAAGCTT
GGAGAGGTACAGCTGACATCATTGCTCAGTATTGCAGCAAGGGCTCACTTATTGGGATCATTGGGCGCTTACAAGTTAGG
TCTTACGAGAAAGACGGTCAGCGTCGATATGTGACTGAAGTAATCGCTGAGAGTGTAGCTCTGCTAGAGAGTCGCAACAG
TCAGCACGGACAAGGCAACAGTTTCCAAAATGGGAATAGCTCACCTTTTACCGATCCTAACCCCTTTGACCTCCCAAATG
ACGGTTTGCCGTTTTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
43.429 |
100 |
0.551 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
43.86 |
100 |
0.543 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
46.377 |
100 |
0.464 |
| ssbA | Streptococcus mutans UA159 |
46.377 |
100 |
0.464 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
43.478 |
100 |
0.435 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
42.754 |
100 |
0.428 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
42.754 |
100 |
0.428 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
42.754 |
100 |
0.428 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
42.754 |
100 |
0.428 |
| ssbB/cilA | Streptococcus mitis SK321 |
42.754 |
100 |
0.428 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
51.887 |
76.812 |
0.399 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
41.86 |
93.478 |
0.391 |