Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | AB6W33_RS01180 | Genome accession | NZ_CP163561 |
| Coordinates | 197706..198179 (+) | Length | 157 a.a. |
| NCBI ID | WP_000609569.1 | Uniprot ID | - |
| Organism | Streptococcus agalactiae strain GBS-B4009 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 189138..230085 | 197706..198179 | within | 0 |
Gene organization within MGE regions
Location: 189138..230085
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB6W33_RS01115 (AB6W33_01120) | - | 190006..190074 (+) | 69 | Protein_163 | competence protein ComGF | - |
| AB6W33_RS01120 (AB6W33_01125) | - | 190083..191537 (-) | 1455 | WP_001044789.1 | recombinase family protein | - |
| AB6W33_RS01125 (AB6W33_01130) | - | 191695..192033 (-) | 339 | WP_000390807.1 | hypothetical protein | - |
| AB6W33_RS01130 (AB6W33_01135) | - | 192037..192465 (-) | 429 | WP_000200806.1 | hypothetical protein | - |
| AB6W33_RS01135 (AB6W33_01140) | - | 192477..193061 (-) | 585 | WP_000823130.1 | hypothetical protein | - |
| AB6W33_RS01140 (AB6W33_01145) | - | 193064..193261 (-) | 198 | WP_000880827.1 | hypothetical protein | - |
| AB6W33_RS01145 (AB6W33_01150) | - | 193280..194020 (-) | 741 | WP_000580170.1 | helix-turn-helix transcriptional regulator | - |
| AB6W33_RS01150 (AB6W33_01155) | - | 194174..194395 (+) | 222 | WP_000215930.1 | helix-turn-helix transcriptional regulator | - |
| AB6W33_RS01155 (AB6W33_01160) | - | 194650..194799 (+) | 150 | WP_001074679.1 | BOW99_gp33 family protein | - |
| AB6W33_RS01160 (AB6W33_01165) | - | 194839..195171 (+) | 333 | WP_000072970.1 | hypothetical protein | - |
| AB6W33_RS01165 (AB6W33_01170) | - | 195392..196063 (+) | 672 | WP_000131170.1 | ERF family protein | - |
| AB6W33_RS01170 (AB6W33_01175) | - | 196067..197062 (+) | 996 | WP_000159058.1 | DUF1351 domain-containing protein | - |
| AB6W33_RS01175 (AB6W33_01180) | - | 197064..197615 (+) | 552 | WP_001010334.1 | MazG-like family protein | - |
| AB6W33_RS01180 (AB6W33_01185) | ssbA | 197706..198179 (+) | 474 | WP_000609569.1 | single-stranded DNA-binding protein | Machinery gene |
| AB6W33_RS01185 (AB6W33_01190) | - | 198176..198454 (+) | 279 | WP_001082484.1 | hypothetical protein | - |
| AB6W33_RS01190 (AB6W33_01195) | - | 198468..199259 (+) | 792 | WP_029667750.1 | DNA methyltransferase | - |
| AB6W33_RS01195 (AB6W33_01200) | - | 199246..199449 (+) | 204 | WP_000163592.1 | hypothetical protein | - |
| AB6W33_RS01200 (AB6W33_01205) | - | 199446..199859 (+) | 414 | WP_000862186.1 | helix-turn-helix domain-containing protein | - |
| AB6W33_RS01205 (AB6W33_01210) | - | 199872..200303 (+) | 432 | WP_000412398.1 | hypothetical protein | - |
| AB6W33_RS01210 (AB6W33_01215) | - | 200305..201039 (+) | 735 | WP_001293548.1 | hypothetical protein | - |
| AB6W33_RS01215 (AB6W33_01220) | - | 201682..202008 (+) | 327 | WP_000836878.1 | DUF1372 family protein | - |
| AB6W33_RS01220 (AB6W33_01225) | - | 202141..202749 (+) | 609 | WP_001019158.1 | DUF1642 domain-containing protein | - |
| AB6W33_RS01225 (AB6W33_01230) | - | 202736..202984 (+) | 249 | WP_000958011.1 | hypothetical protein | - |
| AB6W33_RS01230 (AB6W33_01235) | - | 202995..203390 (+) | 396 | WP_000667207.1 | hypothetical protein | - |
| AB6W33_RS01235 (AB6W33_01240) | - | 203387..203776 (+) | 390 | WP_000614972.1 | YopX family protein | - |
| AB6W33_RS01240 (AB6W33_01245) | - | 203946..204326 (+) | 381 | WP_000164677.1 | hypothetical protein | - |
| AB6W33_RS01245 (AB6W33_01250) | - | 204369..204569 (+) | 201 | WP_001103600.1 | hypothetical protein | - |
| AB6W33_RS01250 (AB6W33_01255) | - | 204592..204807 (+) | 216 | WP_223875938.1 | hypothetical protein | - |
| AB6W33_RS01255 (AB6W33_01260) | - | 204893..205972 (+) | 1080 | WP_001038279.1 | DUF4417 domain-containing protein | - |
| AB6W33_RS01260 (AB6W33_01265) | - | 205962..206372 (+) | 411 | WP_000509432.1 | hypothetical protein | - |
| AB6W33_RS01265 (AB6W33_01270) | - | 206565..207008 (+) | 444 | WP_001136854.1 | hypothetical protein | - |
| AB6W33_RS01270 (AB6W33_01275) | - | 206995..208308 (+) | 1314 | WP_001167688.1 | PBSX family phage terminase large subunit | - |
| AB6W33_RS01275 (AB6W33_01280) | - | 208320..209903 (+) | 1584 | WP_000052338.1 | phage portal protein | - |
| AB6W33_RS01280 (AB6W33_01285) | - | 210002..211171 (+) | 1170 | WP_000140092.1 | phage minor capsid protein | - |
| AB6W33_RS01285 (AB6W33_01290) | - | 211307..211885 (+) | 579 | WP_000011256.1 | phage scaffolding protein | - |
| AB6W33_RS01290 (AB6W33_01295) | - | 211908..212792 (+) | 885 | WP_000224752.1 | hypothetical protein | - |
| AB6W33_RS01295 (AB6W33_01300) | - | 212803..213060 (+) | 258 | WP_001269647.1 | hypothetical protein | - |
| AB6W33_RS01300 (AB6W33_01305) | - | 213102..213491 (+) | 390 | WP_000221832.1 | hypothetical protein | - |
| AB6W33_RS01305 (AB6W33_01310) | - | 213481..213807 (+) | 327 | WP_000565942.1 | putative minor capsid protein | - |
| AB6W33_RS01310 (AB6W33_01315) | - | 213807..214169 (+) | 363 | WP_000077535.1 | minor capsid protein | - |
| AB6W33_RS01315 (AB6W33_01320) | - | 214170..214577 (+) | 408 | WP_001180646.1 | minor capsid protein | - |
| AB6W33_RS01320 (AB6W33_01325) | - | 214580..215035 (+) | 456 | WP_000251918.1 | phage tail tube protein | - |
| AB6W33_RS01325 (AB6W33_01330) | - | 215067..215465 (+) | 399 | WP_000069050.1 | hypothetical protein | - |
| AB6W33_RS01330 (AB6W33_01335) | - | 215468..216052 (+) | 585 | WP_000459714.1 | Gp15 family bacteriophage protein | - |
| AB6W33_RS01335 (AB6W33_01340) | - | 216071..219847 (+) | 3777 | WP_000763172.1 | tape measure protein | - |
| AB6W33_RS01340 (AB6W33_01345) | - | 219840..221288 (+) | 1449 | WP_001293185.1 | distal tail protein Dit | - |
| AB6W33_RS01345 (AB6W33_01350) | - | 221288..224089 (+) | 2802 | WP_001882115.1 | phage tail protein | - |
| AB6W33_RS01350 (AB6W33_01355) | - | 224100..226112 (+) | 2013 | WP_000536261.1 | DUF859 family phage minor structural protein | - |
| AB6W33_RS01355 (AB6W33_01360) | - | 226126..226452 (+) | 327 | WP_000404431.1 | DUF1366 domain-containing protein | - |
| AB6W33_RS01360 (AB6W33_01365) | - | 226427..226639 (+) | 213 | WP_000698337.1 | hypothetical protein | - |
| AB6W33_RS01365 (AB6W33_01370) | - | 226652..226954 (+) | 303 | WP_000215499.1 | hypothetical protein | - |
| AB6W33_RS01370 (AB6W33_01375) | - | 226956..227291 (+) | 336 | WP_001001960.1 | phage holin | - |
| AB6W33_RS01375 (AB6W33_01380) | - | 227293..228012 (+) | 720 | WP_000236381.1 | peptidoglycan amidohydrolase family protein | - |
| AB6W33_RS01380 (AB6W33_01385) | comGF | 228225..228647 (+) | 423 | WP_001264244.1 | competence type IV pilus minor pilin ComGF | - |
| AB6W33_RS01385 (AB6W33_01390) | comGG | 228625..228996 (+) | 372 | WP_000601104.1 | competence type IV pilus minor pilin ComGG | - |
| AB6W33_RS01390 (AB6W33_01395) | comYH | 229111..230085 (+) | 975 | WP_001008574.1 | class I SAM-dependent methyltransferase | Machinery gene |
Sequence
Protein
Download Length: 157 a.a. Molecular weight: 17413.09 Da Isoelectric Point: 4.6460
>NTDB_id=1030597 AB6W33_RS01180 WP_000609569.1 197706..198179(+) (ssbA) [Streptococcus agalactiae strain GBS-B4009]
MINNVVLVGRLTKDAELRYTPSNVAVATFTLAVNRPYKNDAGEREADFINCVIWRQSAENLANWAKKGSLIGITGTIQTR
NYENQQGQRVYVTEVIASNFQLLESRSSQQDNQGGNFQNGNNQGNFGNPGGYQSPFSNSTPMDISDDDLPFQDRSTI
MINNVVLVGRLTKDAELRYTPSNVAVATFTLAVNRPYKNDAGEREADFINCVIWRQSAENLANWAKKGSLIGITGTIQTR
NYENQQGQRVYVTEVIASNFQLLESRSSQQDNQGGNFQNGNNQGNFGNPGGYQSPFSNSTPMDISDDDLPFQDRSTI
Nucleotide
Download Length: 474 bp
>NTDB_id=1030597 AB6W33_RS01180 WP_000609569.1 197706..198179(+) (ssbA) [Streptococcus agalactiae strain GBS-B4009]
ATGATTAACAATGTTGTACTGGTTGGAAGATTGACAAAGGATGCTGAACTAAGATACACGCCATCAAATGTGGCTGTTGC
TACCTTTACTCTCGCAGTTAATCGCCCATACAAAAACGATGCGGGAGAACGAGAGGCTGATTTTATCAATTGTGTTATCT
GGAGACAATCCGCAGAAAACCTTGCTAATTGGGCTAAAAAAGGCTCGTTGATCGGCATTACAGGTACAATTCAAACACGC
AACTACGAAAATCAACAAGGGCAGCGCGTGTATGTGACAGAGGTTATTGCTAGTAATTTCCAACTGCTAGAAAGTCGCAG
TAGTCAGCAAGATAATCAAGGTGGCAATTTCCAAAATGGAAATAACCAAGGTAATTTTGGAAATCCGGGAGGTTATCAAT
CACCATTTAGCAACTCAACTCCTATGGACATCAGCGATGATGATTTGCCTTTCCAAGATAGGAGTACTATATGA
ATGATTAACAATGTTGTACTGGTTGGAAGATTGACAAAGGATGCTGAACTAAGATACACGCCATCAAATGTGGCTGTTGC
TACCTTTACTCTCGCAGTTAATCGCCCATACAAAAACGATGCGGGAGAACGAGAGGCTGATTTTATCAATTGTGTTATCT
GGAGACAATCCGCAGAAAACCTTGCTAATTGGGCTAAAAAAGGCTCGTTGATCGGCATTACAGGTACAATTCAAACACGC
AACTACGAAAATCAACAAGGGCAGCGCGTGTATGTGACAGAGGTTATTGCTAGTAATTTCCAACTGCTAGAAAGTCGCAG
TAGTCAGCAAGATAATCAAGGTGGCAATTTCCAAAATGGAAATAACCAAGGTAATTTTGGAAATCCGGGAGGTTATCAAT
CACCATTTAGCAACTCAACTCCTATGGACATCAGCGATGATGATTTGCCTTTCCAAGATAGGAGTACTATATGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
56.25 |
100 |
0.631 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
58.235 |
100 |
0.631 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
42.484 |
97.452 |
0.414 |
| ssb | Glaesserella parasuis strain SC1401 |
34.463 |
100 |
0.389 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
51.282 |
74.522 |
0.382 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
54.545 |
70.064 |
0.382 |
| ssb | Vibrio cholerae strain A1552 |
33.523 |
100 |
0.376 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
50.427 |
74.522 |
0.376 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
50.427 |
74.522 |
0.376 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
50.427 |
74.522 |
0.376 |
| ssbB/cilA | Streptococcus mitis SK321 |
50.427 |
74.522 |
0.376 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
50.427 |
74.522 |
0.376 |