Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | AB6M99_RS06245 | Genome accession | NZ_CP163513 |
| Coordinates | 1320584..1320979 (-) | Length | 131 a.a. |
| NCBI ID | WP_369350423.1 | Uniprot ID | - |
| Organism | Streptococcus hillyeri strain S23-3001-2 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1292722..1331584 | 1320584..1320979 | within | 0 |
Gene organization within MGE regions
Location: 1292722..1331584
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AB6M99_RS06040 (AB6M99_06040) | - | 1292722..1293453 (-) | 732 | Protein_1179 | CHAP domain-containing protein | - |
| AB6M99_RS06045 (AB6M99_06045) | - | 1293581..1293808 (-) | 228 | WP_369350377.1 | phage holin | - |
| AB6M99_RS06050 (AB6M99_06050) | - | 1293805..1294110 (-) | 306 | WP_369350379.1 | hypothetical protein | - |
| AB6M99_RS06055 (AB6M99_06055) | - | 1294114..1294254 (-) | 141 | WP_183121663.1 | hypothetical protein | - |
| AB6M99_RS06060 (AB6M99_06060) | - | 1294286..1294741 (-) | 456 | WP_369350381.1 | hypothetical protein | - |
| AB6M99_RS06065 (AB6M99_06065) | - | 1294738..1294923 (-) | 186 | WP_369350383.1 | hypothetical protein | - |
| AB6M99_RS06070 (AB6M99_06070) | - | 1294933..1298985 (-) | 4053 | WP_369350385.1 | phage tail spike protein | - |
| AB6M99_RS06075 (AB6M99_06075) | - | 1299007..1299768 (-) | 762 | WP_369350388.1 | hypothetical protein | - |
| AB6M99_RS06080 (AB6M99_06080) | - | 1299771..1301759 (-) | 1989 | WP_369350389.1 | phage tail tape measure protein | - |
| AB6M99_RS06085 (AB6M99_06085) | - | 1301786..1302946 (-) | 1161 | WP_121836465.1 | ISAs1 family transposase | - |
| AB6M99_RS06090 (AB6M99_06090) | - | 1302980..1303486 (-) | 507 | WP_369350390.1 | phage tail tape measure protein | - |
| AB6M99_RS06095 (AB6M99_06095) | - | 1303487..1304098 (-) | 612 | WP_369350391.1 | Gp15 family bacteriophage protein | - |
| AB6M99_RS06100 (AB6M99_06100) | - | 1304106..1304516 (-) | 411 | WP_369350392.1 | hypothetical protein | - |
| AB6M99_RS06105 (AB6M99_06105) | - | 1304532..1305032 (-) | 501 | WP_369350393.1 | phage tail tube protein | - |
| AB6M99_RS06110 (AB6M99_06110) | - | 1305036..1305404 (-) | 369 | WP_369350394.1 | hypothetical protein | - |
| AB6M99_RS06115 (AB6M99_06115) | - | 1305407..1305760 (-) | 354 | WP_369350395.1 | minor capsid protein | - |
| AB6M99_RS06120 (AB6M99_06120) | - | 1305757..1306101 (-) | 345 | WP_369350396.1 | putative minor capsid protein | - |
| AB6M99_RS06125 (AB6M99_06125) | - | 1306095..1306481 (-) | 387 | WP_369350397.1 | hypothetical protein | - |
| AB6M99_RS06130 (AB6M99_06130) | - | 1306484..1306735 (-) | 252 | WP_369350399.1 | hypothetical protein | - |
| AB6M99_RS06135 (AB6M99_06135) | - | 1306749..1307621 (-) | 873 | WP_369350400.1 | hypothetical protein | - |
| AB6M99_RS06140 (AB6M99_06140) | - | 1307635..1308225 (-) | 591 | WP_369350401.1 | hypothetical protein | - |
| AB6M99_RS06145 (AB6M99_06145) | - | 1308225..1308446 (-) | 222 | WP_369350402.1 | hypothetical protein | - |
| AB6M99_RS06150 (AB6M99_06150) | - | 1308536..1308748 (-) | 213 | WP_369350403.1 | hypothetical protein | - |
| AB6M99_RS06155 (AB6M99_06155) | - | 1308760..1309011 (-) | 252 | WP_369350404.1 | DUF6275 family protein | - |
| AB6M99_RS06160 (AB6M99_06160) | - | 1309022..1309297 (-) | 276 | WP_369350405.1 | hypothetical protein | - |
| AB6M99_RS06165 (AB6M99_06165) | - | 1309475..1309696 (-) | 222 | WP_369350406.1 | CPCC family cysteine-rich protein | - |
| AB6M99_RS06170 (AB6M99_06170) | - | 1309662..1311272 (-) | 1611 | WP_369350407.1 | phage minor capsid protein | - |
| AB6M99_RS06175 (AB6M99_06175) | - | 1311272..1312771 (-) | 1500 | WP_369350409.1 | phage portal protein | - |
| AB6M99_RS06180 (AB6M99_06180) | - | 1312781..1314070 (-) | 1290 | WP_369350410.1 | PBSX family phage terminase large subunit | - |
| AB6M99_RS06185 (AB6M99_06185) | terS | 1314073..1314771 (-) | 699 | WP_369350411.1 | phage terminase small subunit | - |
| AB6M99_RS06190 (AB6M99_06190) | - | 1314896..1315330 (-) | 435 | WP_369350412.1 | DUF1492 domain-containing protein | - |
| AB6M99_RS06195 (AB6M99_06195) | - | 1315717..1315932 (-) | 216 | WP_369350413.1 | hypothetical protein | - |
| AB6M99_RS06200 (AB6M99_06200) | - | 1315942..1316151 (-) | 210 | WP_369350414.1 | hypothetical protein | - |
| AB6M99_RS06205 (AB6M99_06205) | - | 1316135..1316389 (-) | 255 | WP_369350416.1 | hypothetical protein | - |
| AB6M99_RS06210 (AB6M99_06210) | - | 1316389..1316925 (-) | 537 | WP_369350417.1 | DUF1642 domain-containing protein | - |
| AB6M99_RS06215 (AB6M99_06215) | - | 1316918..1317232 (-) | 315 | WP_369351203.1 | DUF1372 family protein | - |
| AB6M99_RS06220 (AB6M99_06220) | - | 1317321..1317707 (-) | 387 | WP_369350418.1 | hypothetical protein | - |
| AB6M99_RS06225 (AB6M99_06225) | - | 1317704..1317859 (-) | 156 | WP_369350419.1 | hypothetical protein | - |
| AB6M99_RS06230 (AB6M99_06230) | - | 1317862..1317987 (-) | 126 | WP_369350420.1 | hypothetical protein | - |
| AB6M99_RS06235 (AB6M99_06235) | - | 1318367..1319761 (-) | 1395 | WP_369350421.1 | VapE domain-containing protein | - |
| AB6M99_RS06240 (AB6M99_06240) | - | 1319745..1320572 (-) | 828 | WP_369350422.1 | bifunctional DNA primase/polymerase | - |
| AB6M99_RS06245 (AB6M99_06245) | ssb | 1320584..1320979 (-) | 396 | WP_369350423.1 | single-stranded DNA-binding protein | Machinery gene |
| AB6M99_RS06250 (AB6M99_06250) | - | 1320972..1321163 (-) | 192 | WP_369350424.1 | hypothetical protein | - |
| AB6M99_RS06255 (AB6M99_06255) | - | 1321167..1321877 (-) | 711 | WP_369350425.1 | ERF family protein | - |
| AB6M99_RS06260 (AB6M99_06260) | - | 1322031..1322210 (-) | 180 | WP_369350426.1 | hypothetical protein | - |
| AB6M99_RS06265 (AB6M99_06265) | - | 1322223..1323398 (-) | 1176 | WP_369350427.1 | DEAD/DEAH box helicase family protein | - |
| AB6M99_RS06270 (AB6M99_06270) | - | 1323367..1323831 (-) | 465 | WP_369350428.1 | hypothetical protein | - |
| AB6M99_RS06275 (AB6M99_06275) | - | 1323828..1324310 (-) | 483 | WP_369350429.1 | siphovirus Gp157 family protein | - |
| AB6M99_RS06280 (AB6M99_06280) | - | 1324310..1324642 (-) | 333 | WP_369350430.1 | hypothetical protein | - |
| AB6M99_RS06285 (AB6M99_06285) | - | 1324669..1324914 (-) | 246 | WP_369350431.1 | hypothetical protein | - |
| AB6M99_RS06290 (AB6M99_06290) | - | 1324901..1325074 (-) | 174 | WP_369350432.1 | hypothetical protein | - |
| AB6M99_RS06295 (AB6M99_06295) | - | 1325071..1325214 (-) | 144 | WP_369350433.1 | hypothetical protein | - |
| AB6M99_RS06300 (AB6M99_06300) | - | 1325375..1325641 (-) | 267 | WP_369350434.1 | helix-turn-helix domain-containing protein | - |
| AB6M99_RS06305 (AB6M99_06305) | - | 1325720..1325935 (-) | 216 | WP_369350435.1 | transcriptional regulator | - |
| AB6M99_RS06310 (AB6M99_06310) | - | 1325932..1326129 (-) | 198 | WP_027974611.1 | helix-turn-helix transcriptional regulator | - |
| AB6M99_RS06315 (AB6M99_06315) | - | 1326320..1326463 (+) | 144 | WP_169361579.1 | hypothetical protein | - |
| AB6M99_RS06320 (AB6M99_06320) | - | 1327323..1327685 (+) | 363 | WP_369350436.1 | helix-turn-helix domain-containing protein | - |
| AB6M99_RS06325 (AB6M99_06325) | - | 1327709..1328089 (+) | 381 | WP_369350438.1 | ImmA/IrrE family metallo-endopeptidase | - |
| AB6M99_RS06330 (AB6M99_06330) | - | 1328093..1328818 (+) | 726 | WP_369350439.1 | hypothetical protein | - |
| AB6M99_RS06335 (AB6M99_06335) | - | 1328884..1329432 (+) | 549 | WP_369350440.1 | hypothetical protein | - |
| AB6M99_RS06340 (AB6M99_06340) | - | 1329497..1329919 (+) | 423 | WP_369350441.1 | hypothetical protein | - |
| AB6M99_RS06345 (AB6M99_06345) | - | 1329923..1330336 (+) | 414 | WP_369350442.1 | hypothetical protein | - |
| AB6M99_RS06350 (AB6M99_06350) | - | 1330466..1331584 (+) | 1119 | WP_369350443.1 | tyrosine-type recombinase/integrase | - |
Sequence
Protein
Download Length: 131 a.a. Molecular weight: 14655.31 Da Isoelectric Point: 4.8779
>NTDB_id=1030297 AB6M99_RS06245 WP_369350423.1 1320584..1320979(-) (ssb) [Streptococcus hillyeri strain S23-3001-2]
MINNVVLVGRMTRDAELRYTPSNVAVATFTLAVNRTFKNDAGEREADFINCVIWRQSAENLANWAKKGALIGITGRIQTR
NYENQQGQRVYVTEVVAESFQLLESRNQQGNQEGAFGNSSPADIKDDDLPF
MINNVVLVGRMTRDAELRYTPSNVAVATFTLAVNRTFKNDAGEREADFINCVIWRQSAENLANWAKKGALIGITGRIQTR
NYENQQGQRVYVTEVVAESFQLLESRNQQGNQEGAFGNSSPADIKDDDLPF
Nucleotide
Download Length: 396 bp
>NTDB_id=1030297 AB6M99_RS06245 WP_369350423.1 1320584..1320979(-) (ssb) [Streptococcus hillyeri strain S23-3001-2]
ATGATTAACAATGTCGTACTTGTGGGGCGTATGACCCGTGATGCAGAACTTCGTTACACACCCTCAAATGTAGCTGTTGC
TACGTTTACTCTTGCTGTGAACCGCACTTTTAAAAATGATGCCGGGGAGCGTGAAGCAGACTTCATCAACTGTGTGATTT
GGCGGCAGTCAGCAGAGAACTTAGCGAACTGGGCTAAAAAAGGTGCTTTGATTGGCATTACTGGTCGCATTCAAACACGA
AACTATGAGAATCAACAAGGGCAACGTGTCTATGTGACAGAGGTTGTCGCAGAAAGTTTCCAACTCTTGGAAAGTCGTAA
TCAGCAAGGCAACCAAGAAGGTGCGTTTGGAAATAGCAGTCCTGCTGATATTAAGGATGATGATTTACCATTCTAA
ATGATTAACAATGTCGTACTTGTGGGGCGTATGACCCGTGATGCAGAACTTCGTTACACACCCTCAAATGTAGCTGTTGC
TACGTTTACTCTTGCTGTGAACCGCACTTTTAAAAATGATGCCGGGGAGCGTGAAGCAGACTTCATCAACTGTGTGATTT
GGCGGCAGTCAGCAGAGAACTTAGCGAACTGGGCTAAAAAAGGTGCTTTGATTGGCATTACTGGTCGCATTCAAACACGA
AACTATGAGAATCAACAAGGGCAACGTGTCTATGTGACAGAGGTTGTCGCAGAAAGTTTCCAACTCTTGGAAAGTCGTAA
TCAGCAAGGCAACCAAGAAGGTGCGTTTGGAAATAGCAGTCCTGCTGATATTAAGGATGATGATTTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.294 |
100 |
0.718 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
54.651 |
100 |
0.718 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
48.529 |
100 |
0.504 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
47.368 |
100 |
0.481 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
46.617 |
100 |
0.473 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
46.617 |
100 |
0.473 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
46.617 |
100 |
0.473 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
46.617 |
100 |
0.473 |
| ssbB/cilA | Streptococcus mitis SK321 |
46.617 |
100 |
0.473 |
| ssbA | Streptococcus mutans UA159 |
44.118 |
100 |
0.458 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
54.128 |
83.206 |
0.45 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
47.368 |
87.023 |
0.412 |