Detailed information
Bioinformatically predicted
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | ABXJ36_RS04520 | Genome accession | NZ_CP159631 |
| Coordinates | 899353..899628 (-) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain Z217-1 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 856355..899329 | 899353..899628 | flank | 24 |
Gene organization within MGE regions
Location: 856355..899628
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABXJ36_RS04220 (ABXJ36_04220) | - | 856355..857362 (-) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| ABXJ36_RS04225 (ABXJ36_04225) | comGG | 857491..857844 (-) | 354 | WP_002357061.1 | competence type IV pilus minor pilin ComGG | - |
| ABXJ36_RS04230 (ABXJ36_04230) | comGF | 857844..858278 (-) | 435 | WP_033626933.1 | competence type IV pilus minor pilin ComGF | - |
| ABXJ36_RS04235 (ABXJ36_04235) | - | 858268..858669 (-) | 402 | WP_002410542.1 | type II secretion system protein | - |
| ABXJ36_RS04240 (ABXJ36_04240) | hemH | 859396..860337 (-) | 942 | WP_002364185.1 | ferrochelatase | - |
| ABXJ36_RS04250 (ABXJ36_04250) | - | 861077..861325 (-) | 249 | WP_002383136.1 | hypothetical protein | - |
| ABXJ36_RS04255 (ABXJ36_04255) | - | 861397..861597 (-) | 201 | WP_002357053.1 | cold-shock protein | - |
| ABXJ36_RS04260 (ABXJ36_04260) | - | 862434..863675 (-) | 1242 | WP_002370962.1 | LysM peptidoglycan-binding domain-containing protein | - |
| ABXJ36_RS04265 (ABXJ36_04265) | - | 863676..863909 (-) | 234 | WP_002384371.1 | phage holin | - |
| ABXJ36_RS04270 (ABXJ36_04270) | - | 863902..864123 (-) | 222 | WP_002364191.1 | hypothetical protein | - |
| ABXJ36_RS04275 (ABXJ36_04275) | - | 864158..864313 (-) | 156 | WP_002364192.1 | XkdX family protein | - |
| ABXJ36_RS04280 (ABXJ36_04280) | - | 864315..864635 (-) | 321 | WP_002389262.1 | hypothetical protein | - |
| ABXJ36_RS04285 (ABXJ36_04285) | - | 864649..865140 (-) | 492 | WP_002364194.1 | hypothetical protein | - |
| ABXJ36_RS04290 (ABXJ36_04290) | - | 865140..865427 (-) | 288 | WP_002357046.1 | collagen-like protein | - |
| ABXJ36_RS04295 (ABXJ36_04295) | - | 865424..866020 (-) | 597 | WP_002357045.1 | hypothetical protein | - |
| ABXJ36_RS04300 (ABXJ36_04300) | - | 866013..866894 (-) | 882 | WP_002387290.1 | phage baseplate upper protein | - |
| ABXJ36_RS04305 (ABXJ36_04305) | - | 866913..869720 (-) | 2808 | WP_002384367.1 | phage tail spike protein | - |
| ABXJ36_RS04310 (ABXJ36_04310) | - | 869702..870436 (-) | 735 | WP_002403868.1 | tail protein | - |
| ABXJ36_RS04315 (ABXJ36_04315) | - | 870426..873323 (-) | 2898 | WP_354017711.1 | tape measure protein | - |
| ABXJ36_RS04320 (ABXJ36_04320) | - | 873571..873921 (-) | 351 | WP_002357039.1 | hypothetical protein | - |
| ABXJ36_RS04325 (ABXJ36_04325) | - | 873974..874822 (-) | 849 | WP_002387287.1 | major tail protein | - |
| ABXJ36_RS04330 (ABXJ36_04330) | - | 874823..875197 (-) | 375 | WP_002387286.1 | DUF6838 family protein | - |
| ABXJ36_RS04335 (ABXJ36_04335) | - | 875200..875598 (-) | 399 | WP_002357036.1 | HK97 gp10 family phage protein | - |
| ABXJ36_RS04340 (ABXJ36_04340) | - | 875591..875965 (-) | 375 | WP_002387285.1 | hypothetical protein | - |
| ABXJ36_RS04345 (ABXJ36_04345) | - | 875962..876306 (-) | 345 | WP_002387282.1 | hypothetical protein | - |
| ABXJ36_RS04350 (ABXJ36_04350) | - | 876320..876502 (-) | 183 | WP_002387281.1 | hypothetical protein | - |
| ABXJ36_RS04355 (ABXJ36_04355) | - | 876531..877418 (-) | 888 | WP_354017701.1 | DUF5309 domain-containing protein | - |
| ABXJ36_RS04360 (ABXJ36_04360) | - | 877432..878055 (-) | 624 | WP_010706493.1 | DUF4355 domain-containing protein | - |
| ABXJ36_RS04365 (ABXJ36_04365) | - | 878274..878594 (-) | 321 | WP_002380436.1 | hypothetical protein | - |
| ABXJ36_RS04370 (ABXJ36_04370) | - | 878597..879643 (-) | 1047 | WP_311812566.1 | phage head morphogenesis protein | - |
| ABXJ36_RS04375 (ABXJ36_04375) | - | 879618..881090 (-) | 1473 | WP_010717875.1 | phage portal protein | - |
| ABXJ36_RS04380 (ABXJ36_04380) | terL | 881102..882490 (-) | 1389 | WP_029657252.1 | phage terminase large subunit | - |
| ABXJ36_RS04385 (ABXJ36_04385) | - | 882483..883202 (-) | 720 | WP_010716856.1 | terminase small subunit | - |
| ABXJ36_RS04390 (ABXJ36_04390) | - | 883217..883447 (-) | 231 | WP_010711272.1 | hypothetical protein | - |
| ABXJ36_RS04395 (ABXJ36_04395) | - | 883569..883760 (-) | 192 | WP_354017700.1 | hypothetical protein | - |
| ABXJ36_RS04400 (ABXJ36_04400) | - | 883798..885132 (-) | 1335 | WP_033599682.1 | DNA methyltransferase | - |
| ABXJ36_RS04405 (ABXJ36_04405) | - | 885135..885368 (-) | 234 | WP_033599680.1 | hypothetical protein | - |
| ABXJ36_RS04410 (ABXJ36_04410) | - | 885989..886669 (-) | 681 | WP_010820923.1 | hypothetical protein | - |
| ABXJ36_RS04415 (ABXJ36_04415) | - | 886683..887621 (-) | 939 | WP_010820924.1 | hypothetical protein | - |
| ABXJ36_RS04425 (ABXJ36_04425) | - | 888331..888747 (-) | 417 | WP_002357018.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| ABXJ36_RS04430 (ABXJ36_04430) | - | 889655..890063 (-) | 409 | Protein_860 | RusA family crossover junction endodeoxyribonuclease | - |
| ABXJ36_RS04435 (ABXJ36_04435) | - | 890060..890929 (-) | 870 | WP_354017699.1 | helix-turn-helix domain-containing protein | - |
| ABXJ36_RS04440 (ABXJ36_04440) | - | 890929..891129 (-) | 201 | WP_354017698.1 | hypothetical protein | - |
| ABXJ36_RS04445 (ABXJ36_04445) | - | 891134..891775 (-) | 642 | WP_002364344.1 | putative HNHc nuclease | - |
| ABXJ36_RS04450 (ABXJ36_04450) | - | 891780..892514 (-) | 735 | WP_002383799.1 | ERF family protein | - |
| ABXJ36_RS04455 (ABXJ36_04455) | - | 892507..892824 (-) | 318 | WP_002383798.1 | hypothetical protein | - |
| ABXJ36_RS04460 (ABXJ36_04460) | - | 893020..893358 (-) | 339 | WP_354017697.1 | hypothetical protein | - |
| ABXJ36_RS04465 (ABXJ36_04465) | - | 893395..893604 (-) | 210 | WP_010828872.1 | hypothetical protein | - |
| ABXJ36_RS04470 (ABXJ36_04470) | - | 893659..893847 (+) | 189 | WP_002357001.1 | YegP family protein | - |
| ABXJ36_RS04475 (ABXJ36_04475) | - | 893873..894598 (-) | 726 | WP_338349015.1 | ORF6C domain-containing protein | - |
| ABXJ36_RS04480 (ABXJ36_04480) | - | 894637..894954 (-) | 318 | WP_002356999.1 | hypothetical protein | - |
| ABXJ36_RS04485 (ABXJ36_04485) | - | 894960..895151 (-) | 192 | WP_002356998.1 | hypothetical protein | - |
| ABXJ36_RS04490 (ABXJ36_04490) | - | 895443..895784 (+) | 342 | WP_002396615.1 | helix-turn-helix transcriptional regulator | - |
| ABXJ36_RS04495 (ABXJ36_04495) | - | 895789..896436 (+) | 648 | WP_311812563.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ABXJ36_RS04500 (ABXJ36_04500) | - | 896536..897318 (+) | 783 | WP_354017710.1 | LysM domain-containing protein | - |
| ABXJ36_RS04505 (ABXJ36_04505) | - | 897333..897662 (+) | 330 | WP_311812561.1 | hypothetical protein | - |
| ABXJ36_RS04510 (ABXJ36_04510) | - | 897737..898885 (+) | 1149 | WP_311812560.1 | site-specific integrase | - |
| ABXJ36_RS04515 (ABXJ36_04515) | comGD | 898922..899356 (-) | 435 | Protein_877 | competence type IV pilus minor pilin ComGD | - |
| ABXJ36_RS04520 (ABXJ36_04520) | comGC/cglC | 899353..899628 (-) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=1015054 ABXJ36_RS04520 WP_002356991.1 899353..899628(-) (comGC/cglC) [Enterococcus faecalis strain Z217-1]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=1015054 ABXJ36_RS04520 WP_002356991.1 899353..899628(-) (comGC/cglC) [Enterococcus faecalis strain Z217-1]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |