Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | ABXJ33_RS04745 | Genome accession | NZ_CP159629 |
| Coordinates | 1003646..1003921 (+) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain Z217-3 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1003945..1056309 | 1003646..1003921 | flank | 24 |
Gene organization within MGE regions
Location: 1003646..1056309
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABXJ33_RS04745 (ABXJ33_04745) | comGC/cglC | 1003646..1003921 (+) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| ABXJ33_RS04750 (ABXJ33_04750) | comGD | 1003918..1004352 (+) | 435 | Protein_929 | competence type IV pilus minor pilin ComGD | - |
| ABXJ33_RS04755 (ABXJ33_04755) | - | 1004389..1005537 (-) | 1149 | WP_311812560.1 | site-specific integrase | - |
| ABXJ33_RS04760 (ABXJ33_04760) | - | 1005612..1005941 (-) | 330 | WP_311812561.1 | hypothetical protein | - |
| ABXJ33_RS04765 (ABXJ33_04765) | - | 1005956..1006738 (-) | 783 | WP_354017710.1 | LysM domain-containing protein | - |
| ABXJ33_RS04770 (ABXJ33_04770) | - | 1006838..1007485 (-) | 648 | WP_311812563.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ABXJ33_RS04775 (ABXJ33_04775) | - | 1007490..1007831 (-) | 342 | WP_002396615.1 | helix-turn-helix transcriptional regulator | - |
| ABXJ33_RS04780 (ABXJ33_04780) | - | 1008123..1008314 (+) | 192 | WP_002356998.1 | hypothetical protein | - |
| ABXJ33_RS04785 (ABXJ33_04785) | - | 1008320..1008637 (+) | 318 | WP_002356999.1 | hypothetical protein | - |
| ABXJ33_RS04790 (ABXJ33_04790) | - | 1008676..1009401 (+) | 726 | WP_338349015.1 | ORF6C domain-containing protein | - |
| ABXJ33_RS04795 (ABXJ33_04795) | - | 1009427..1009615 (-) | 189 | WP_002357001.1 | YegP family protein | - |
| ABXJ33_RS04800 (ABXJ33_04800) | - | 1009670..1009879 (+) | 210 | WP_010828872.1 | hypothetical protein | - |
| ABXJ33_RS04805 (ABXJ33_04805) | - | 1009916..1010254 (+) | 339 | WP_354017697.1 | hypothetical protein | - |
| ABXJ33_RS04810 (ABXJ33_04810) | - | 1010450..1010767 (+) | 318 | WP_002383798.1 | hypothetical protein | - |
| ABXJ33_RS04815 (ABXJ33_04815) | - | 1010760..1011494 (+) | 735 | WP_002383799.1 | ERF family protein | - |
| ABXJ33_RS04820 (ABXJ33_04820) | - | 1011499..1012140 (+) | 642 | WP_002364344.1 | putative HNHc nuclease | - |
| ABXJ33_RS04825 (ABXJ33_04825) | - | 1012145..1012345 (+) | 201 | WP_354017698.1 | hypothetical protein | - |
| ABXJ33_RS04830 (ABXJ33_04830) | - | 1012345..1013214 (+) | 870 | WP_354017699.1 | helix-turn-helix domain-containing protein | - |
| ABXJ33_RS04835 (ABXJ33_04835) | - | 1013211..1013619 (+) | 409 | Protein_946 | RusA family crossover junction endodeoxyribonuclease | - |
| ABXJ33_RS04840 (ABXJ33_04840) | - | 1013899..1014159 (+) | 261 | WP_002383807.1 | hypothetical protein | - |
| ABXJ33_RS04845 (ABXJ33_04845) | - | 1014527..1014943 (+) | 417 | WP_002357018.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| ABXJ33_RS04855 (ABXJ33_04855) | - | 1015653..1016591 (+) | 939 | WP_010820924.1 | hypothetical protein | - |
| ABXJ33_RS04860 (ABXJ33_04860) | - | 1016605..1017285 (+) | 681 | WP_010820923.1 | hypothetical protein | - |
| ABXJ33_RS04865 (ABXJ33_04865) | - | 1017906..1018139 (+) | 234 | WP_033599680.1 | hypothetical protein | - |
| ABXJ33_RS04870 (ABXJ33_04870) | - | 1018142..1019476 (+) | 1335 | WP_033599682.1 | DNA methyltransferase | - |
| ABXJ33_RS04875 (ABXJ33_04875) | - | 1019514..1019705 (+) | 192 | WP_354017700.1 | hypothetical protein | - |
| ABXJ33_RS04880 (ABXJ33_04880) | - | 1019827..1020057 (+) | 231 | WP_010711272.1 | hypothetical protein | - |
| ABXJ33_RS04885 (ABXJ33_04885) | - | 1020072..1020791 (+) | 720 | WP_010716856.1 | terminase small subunit | - |
| ABXJ33_RS04890 (ABXJ33_04890) | terL | 1020784..1022172 (+) | 1389 | WP_029657252.1 | phage terminase large subunit | - |
| ABXJ33_RS04895 (ABXJ33_04895) | - | 1022184..1023656 (+) | 1473 | WP_010717875.1 | phage portal protein | - |
| ABXJ33_RS04900 (ABXJ33_04900) | - | 1023631..1024677 (+) | 1047 | WP_311812566.1 | phage head morphogenesis protein | - |
| ABXJ33_RS04905 (ABXJ33_04905) | - | 1024680..1025000 (+) | 321 | WP_002380436.1 | hypothetical protein | - |
| ABXJ33_RS04910 (ABXJ33_04910) | - | 1025219..1025842 (+) | 624 | WP_010706493.1 | DUF4355 domain-containing protein | - |
| ABXJ33_RS04915 (ABXJ33_04915) | - | 1025856..1026743 (+) | 888 | WP_354017701.1 | DUF5309 domain-containing protein | - |
| ABXJ33_RS04920 (ABXJ33_04920) | - | 1026772..1026954 (+) | 183 | WP_002387281.1 | hypothetical protein | - |
| ABXJ33_RS04925 (ABXJ33_04925) | - | 1026968..1027312 (+) | 345 | WP_002387282.1 | hypothetical protein | - |
| ABXJ33_RS04930 (ABXJ33_04930) | - | 1027309..1027683 (+) | 375 | WP_002387285.1 | hypothetical protein | - |
| ABXJ33_RS04935 (ABXJ33_04935) | - | 1027676..1028074 (+) | 399 | WP_002357036.1 | HK97 gp10 family phage protein | - |
| ABXJ33_RS04940 (ABXJ33_04940) | - | 1028077..1028451 (+) | 375 | WP_002387286.1 | DUF6838 family protein | - |
| ABXJ33_RS04945 (ABXJ33_04945) | - | 1028452..1029300 (+) | 849 | WP_002387287.1 | major tail protein | - |
| ABXJ33_RS04950 (ABXJ33_04950) | - | 1029353..1029703 (+) | 351 | WP_002357039.1 | hypothetical protein | - |
| ABXJ33_RS04955 (ABXJ33_04955) | - | 1029951..1032848 (+) | 2898 | WP_354017711.1 | tape measure protein | - |
| ABXJ33_RS04960 (ABXJ33_04960) | - | 1032838..1033572 (+) | 735 | WP_002403868.1 | tail protein | - |
| ABXJ33_RS04965 (ABXJ33_04965) | - | 1033554..1036361 (+) | 2808 | WP_002384367.1 | phage tail spike protein | - |
| ABXJ33_RS04970 (ABXJ33_04970) | - | 1036380..1037261 (+) | 882 | WP_002387290.1 | phage baseplate upper protein | - |
| ABXJ33_RS04975 (ABXJ33_04975) | - | 1037254..1037850 (+) | 597 | WP_002357045.1 | hypothetical protein | - |
| ABXJ33_RS04980 (ABXJ33_04980) | - | 1037847..1038134 (+) | 288 | WP_002357046.1 | collagen-like protein | - |
| ABXJ33_RS04985 (ABXJ33_04985) | - | 1038134..1038625 (+) | 492 | WP_002364194.1 | hypothetical protein | - |
| ABXJ33_RS04990 (ABXJ33_04990) | - | 1038639..1038959 (+) | 321 | WP_002389262.1 | hypothetical protein | - |
| ABXJ33_RS04995 (ABXJ33_04995) | - | 1038961..1039116 (+) | 156 | WP_002364192.1 | XkdX family protein | - |
| ABXJ33_RS05000 (ABXJ33_05000) | - | 1039151..1039372 (+) | 222 | WP_002364191.1 | hypothetical protein | - |
| ABXJ33_RS05005 (ABXJ33_05005) | - | 1039365..1039598 (+) | 234 | WP_002384371.1 | phage holin | - |
| ABXJ33_RS05010 (ABXJ33_05010) | - | 1039599..1040840 (+) | 1242 | WP_002370962.1 | LysM peptidoglycan-binding domain-containing protein | - |
| ABXJ33_RS05015 (ABXJ33_05015) | - | 1041677..1041877 (+) | 201 | WP_002357053.1 | cold-shock protein | - |
| ABXJ33_RS05020 (ABXJ33_05020) | - | 1041949..1042197 (+) | 249 | WP_002383136.1 | hypothetical protein | - |
| ABXJ33_RS05030 (ABXJ33_05030) | hemH | 1042937..1043878 (+) | 942 | WP_002364185.1 | ferrochelatase | - |
| ABXJ33_RS05035 (ABXJ33_05035) | - | 1044175..1044300 (-) | 126 | WP_002364184.1 | hypothetical protein | - |
| ABXJ33_RS05040 (ABXJ33_05040) | - | 1044605..1045006 (+) | 402 | WP_002410542.1 | type II secretion system protein | - |
| ABXJ33_RS05045 (ABXJ33_05045) | comGF | 1044996..1045430 (+) | 435 | WP_033626933.1 | competence type IV pilus minor pilin ComGF | - |
| ABXJ33_RS05050 (ABXJ33_05050) | comGG | 1045430..1045783 (+) | 354 | WP_002357061.1 | competence type IV pilus minor pilin ComGG | - |
| ABXJ33_RS05055 (ABXJ33_05055) | - | 1045912..1046919 (+) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| ABXJ33_RS05060 (ABXJ33_05060) | - | 1046944..1048131 (+) | 1188 | WP_033626932.1 | acetate kinase | - |
| ABXJ33_RS05065 (ABXJ33_05065) | - | 1048243..1048716 (-) | 474 | WP_002357065.1 | universal stress protein | - |
| ABXJ33_RS05070 (ABXJ33_05070) | - | 1049034..1049312 (-) | 279 | WP_354017702.1 | hypothetical protein | - |
| ABXJ33_RS05080 (ABXJ33_05080) | - | 1049639..1050916 (-) | 1278 | WP_002360030.1 | replication-associated recombination protein A | - |
| ABXJ33_RS05085 (ABXJ33_05085) | - | 1051045..1051722 (+) | 678 | WP_002364174.1 | DNA-3-methyladenine glycosylase | - |
| ABXJ33_RS05090 (ABXJ33_05090) | - | 1051679..1052164 (+) | 486 | WP_002388170.1 | DUF3013 family protein | - |
| ABXJ33_RS05095 (ABXJ33_05095) | prmA | 1052180..1053127 (+) | 948 | WP_002357075.1 | 50S ribosomal protein L11 methyltransferase | - |
| ABXJ33_RS05100 (ABXJ33_05100) | - | 1053129..1053881 (+) | 753 | WP_002357078.1 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
| ABXJ33_RS05105 (ABXJ33_05105) | - | 1054096..1056309 (+) | 2214 | WP_002357079.1 | bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=1015001 ABXJ33_RS04745 WP_002356991.1 1003646..1003921(+) (comGC/cglC) [Enterococcus faecalis strain Z217-3]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=1015001 ABXJ33_RS04745 WP_002356991.1 1003646..1003921(+) (comGC/cglC) [Enterococcus faecalis strain Z217-3]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCTTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |