Detailed information
Overview
| Name | comGC/cglC | Type | Machinery gene |
| Locus tag | QUD80_RS08540 | Genome accession | NZ_AP027302 |
| Coordinates | 1814341..1814616 (+) | Length | 91 a.a. |
| NCBI ID | WP_002356991.1 | Uniprot ID | A0A1B4XPV0 |
| Organism | Enterococcus faecalis strain N4E | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1814640..1866327 | 1814341..1814616 | flank | 24 |
Gene organization within MGE regions
Location: 1814341..1866327
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QUD80_RS08540 (N4E_16670) | comGC/cglC | 1814341..1814616 (+) | 276 | WP_002356991.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| QUD80_RS08545 (N4E_16680) | comGD | 1814613..1815047 (+) | 435 | Protein_1663 | competence type IV pilus minor pilin ComGD | - |
| QUD80_RS08550 (N4E_16690) | - | 1815084..1816232 (-) | 1149 | WP_002387264.1 | site-specific integrase | - |
| QUD80_RS08555 (N4E_16700) | - | 1816338..1816967 (-) | 630 | WP_002410530.1 | SHOCT domain-containing protein | - |
| QUD80_RS08560 (N4E_16710) | - | 1817063..1817713 (-) | 651 | WP_002387266.1 | ImmA/IrrE family metallo-endopeptidase | - |
| QUD80_RS08565 (N4E_16720) | - | 1817718..1818059 (-) | 342 | WP_002387267.1 | helix-turn-helix transcriptional regulator | - |
| QUD80_RS08570 (N4E_16730) | - | 1818355..1818546 (+) | 192 | WP_002383936.1 | hypothetical protein | - |
| QUD80_RS08575 (N4E_16740) | - | 1818558..1818869 (+) | 312 | WP_002403885.1 | hypothetical protein | - |
| QUD80_RS08580 (N4E_16750) | - | 1818892..1819614 (+) | 723 | WP_002410531.1 | ORF6C domain-containing protein | - |
| QUD80_RS08585 (N4E_16760) | - | 1819640..1819828 (-) | 189 | WP_002357001.1 | YegP family protein | - |
| QUD80_RS08590 (N4E_16770) | - | 1819883..1820092 (+) | 210 | WP_002378465.1 | hypothetical protein | - |
| QUD80_RS08595 (N4E_16780) | - | 1820129..1820467 (+) | 339 | WP_002402484.1 | hypothetical protein | - |
| QUD80_RS08600 (N4E_16790) | - | 1820663..1820980 (+) | 318 | WP_002402485.1 | hypothetical protein | - |
| QUD80_RS08605 (N4E_16800) | - | 1820973..1821707 (+) | 735 | WP_002402486.1 | ERF family protein | - |
| QUD80_RS08610 (N4E_16810) | - | 1821712..1822353 (+) | 642 | WP_002402487.1 | putative HNHc nuclease | - |
| QUD80_RS08615 (N4E_16820) | - | 1822358..1822558 (+) | 201 | WP_010816620.1 | hypothetical protein | - |
| QUD80_RS08620 (N4E_16830) | - | 1822558..1823430 (+) | 873 | WP_010715319.1 | helix-turn-helix domain-containing protein | - |
| QUD80_RS08625 (N4E_16840) | - | 1823427..1823729 (+) | 303 | WP_002368214.1 | hypothetical protein | - |
| QUD80_RS08630 (N4E_16850) | - | 1823730..1824029 (+) | 300 | WP_002372047.1 | MazG-like family protein | - |
| QUD80_RS08635 (N4E_16860) | - | 1824038..1824472 (+) | 435 | WP_002402491.1 | RusA family crossover junction endodeoxyribonuclease | - |
| QUD80_RS08640 (N4E_16890) | - | 1825379..1825795 (+) | 417 | WP_002372045.1 | ArpU family phage packaging/lysis transcriptional regulator | - |
| QUD80_RS08650 (N4E_16900) | - | 1826791..1827024 (+) | 234 | WP_002410538.1 | hypothetical protein | - |
| QUD80_RS08655 (N4E_16910) | - | 1827168..1827746 (+) | 579 | WP_002370953.1 | sce7726 family protein | - |
| QUD80_RS08660 (N4E_16920) | - | 1827784..1828701 (-) | 918 | WP_002370955.1 | hypothetical protein | - |
| QUD80_RS08665 (N4E_16930) | terS | 1828970..1829773 (+) | 804 | WP_010816619.1 | phage terminase small subunit | - |
| QUD80_RS08670 (N4E_16940) | - | 1829745..1831034 (+) | 1290 | WP_002393615.1 | PBSX family phage terminase large subunit | - |
| QUD80_RS08675 (N4E_16950) | - | 1831046..1832533 (+) | 1488 | WP_002393614.1 | phage portal protein | - |
| QUD80_RS08680 (N4E_16960) | - | 1832508..1834412 (+) | 1905 | WP_002393613.1 | hypothetical protein | - |
| QUD80_RS08685 (N4E_16970) | - | 1834413..1834643 (+) | 231 | WP_002380437.1 | hypothetical protein | - |
| QUD80_RS08690 (N4E_16980) | - | 1834700..1835020 (+) | 321 | WP_002380436.1 | hypothetical protein | - |
| QUD80_RS08695 (N4E_16990) | - | 1835239..1835862 (+) | 624 | WP_002393977.1 | DUF4355 domain-containing protein | - |
| QUD80_RS08700 (N4E_17000) | - | 1835876..1836763 (+) | 888 | WP_002357030.1 | DUF5309 domain-containing protein | - |
| QUD80_RS08705 (N4E_17010) | - | 1836792..1836974 (+) | 183 | WP_002357032.1 | hypothetical protein | - |
| QUD80_RS08710 (N4E_17020) | - | 1836988..1837332 (+) | 345 | WP_002357033.1 | hypothetical protein | - |
| QUD80_RS08715 (N4E_17030) | - | 1837329..1837697 (+) | 369 | WP_002357034.1 | hypothetical protein | - |
| QUD80_RS08720 (N4E_17040) | - | 1837690..1838088 (+) | 399 | WP_002357036.1 | HK97 gp10 family phage protein | - |
| QUD80_RS08725 (N4E_17050) | - | 1838091..1838465 (+) | 375 | WP_002387286.1 | DUF6838 family protein | - |
| QUD80_RS08730 (N4E_17060) | - | 1838466..1839314 (+) | 849 | WP_002387287.1 | major tail protein | - |
| QUD80_RS08735 (N4E_17070) | - | 1839367..1839717 (+) | 351 | WP_002357039.1 | hypothetical protein | - |
| QUD80_RS08740 (N4E_17080) | - | 1839965..1842862 (+) | 2898 | WP_002410539.1 | tape measure protein | - |
| QUD80_RS08745 (N4E_17090) | - | 1842852..1843586 (+) | 735 | WP_002403868.1 | tail protein | - |
| QUD80_RS08750 (N4E_17100) | - | 1843568..1846375 (+) | 2808 | WP_002410540.1 | phage tail spike protein | - |
| QUD80_RS08755 (N4E_17110) | - | 1846394..1847275 (+) | 882 | WP_002387290.1 | phage baseplate upper protein | - |
| QUD80_RS08760 (N4E_17120) | - | 1847268..1847864 (+) | 597 | WP_002357045.1 | hypothetical protein | - |
| QUD80_RS08765 (N4E_17130) | - | 1847861..1848148 (+) | 288 | WP_002357046.1 | collagen-like protein | - |
| QUD80_RS08770 (N4E_17140) | - | 1848148..1848639 (+) | 492 | WP_002364194.1 | hypothetical protein | - |
| QUD80_RS08775 (N4E_17150) | - | 1848653..1848973 (+) | 321 | WP_002389262.1 | hypothetical protein | - |
| QUD80_RS08780 (N4E_17160) | - | 1848975..1849130 (+) | 156 | WP_002364192.1 | XkdX family protein | - |
| QUD80_RS08785 (N4E_17170) | - | 1849165..1849386 (+) | 222 | WP_002364191.1 | hypothetical protein | - |
| QUD80_RS08790 (N4E_17180) | - | 1849379..1849612 (+) | 234 | WP_002384371.1 | phage holin | - |
| QUD80_RS08795 (N4E_17190) | - | 1849613..1850854 (+) | 1242 | WP_002394567.1 | LysM peptidoglycan-binding domain-containing protein | - |
| QUD80_RS08800 (N4E_17200) | - | 1851691..1851891 (+) | 201 | WP_002357053.1 | cold-shock protein | - |
| QUD80_RS08805 (N4E_17210) | - | 1851963..1852214 (+) | 252 | WP_002364188.1 | hypothetical protein | - |
| QUD80_RS08815 (N4E_17220) | hemH | 1852958..1853899 (+) | 942 | WP_033595884.1 | ferrochelatase | - |
| QUD80_RS08820 (N4E_17230) | - | 1854196..1854321 (-) | 126 | WP_002364184.1 | hypothetical protein | - |
| QUD80_RS08825 (N4E_17240) | - | 1854655..1855026 (+) | 372 | WP_002365830.1 | type II secretion system protein | - |
| QUD80_RS08830 (N4E_17250) | comGF | 1855016..1855450 (+) | 435 | WP_002357060.1 | competence type IV pilus minor pilin ComGF | - |
| QUD80_RS08835 (N4E_17260) | comGG | 1855450..1855803 (+) | 354 | WP_002357061.1 | competence type IV pilus minor pilin ComGG | - |
| QUD80_RS08840 (N4E_17270) | - | 1855932..1856939 (+) | 1008 | WP_002357063.1 | class I SAM-dependent methyltransferase | - |
| QUD80_RS08845 (N4E_17280) | - | 1856964..1858151 (+) | 1188 | WP_002362052.1 | acetate kinase | - |
| QUD80_RS08850 (N4E_17290) | - | 1858263..1858736 (-) | 474 | WP_002357065.1 | universal stress protein | - |
| QUD80_RS08855 (N4E_17300) | - | 1859051..1859329 (-) | 279 | WP_002380425.1 | hypothetical protein | - |
| QUD80_RS08865 (N4E_17310) | - | 1859657..1860934 (-) | 1278 | WP_174114184.1 | replication-associated recombination protein A | - |
| QUD80_RS08870 (N4E_17320) | - | 1861063..1861740 (+) | 678 | WP_002364174.1 | DNA-3-methyladenine glycosylase | - |
| QUD80_RS08875 (N4E_17330) | - | 1861697..1862182 (+) | 486 | WP_002388170.1 | DUF3013 family protein | - |
| QUD80_RS08880 (N4E_17340) | prmA | 1862198..1863145 (+) | 948 | WP_002371999.1 | 50S ribosomal protein L11 methyltransferase | - |
| QUD80_RS08885 (N4E_17350) | - | 1863147..1863899 (+) | 753 | WP_002357078.1 | 16S rRNA (uracil(1498)-N(3))-methyltransferase | - |
| QUD80_RS08890 (N4E_17360) | - | 1864114..1866327 (+) | 2214 | WP_002380422.1 | bifunctional (p)ppGpp synthetase/guanosine-3',5'-bis(diphosphate) 3'-pyrophosphohydrolase | - |
Sequence
Protein
Download Length: 91 a.a. Molecular weight: 10464.41 Da Isoelectric Point: 9.3192
>NTDB_id=100770 QUD80_RS08540 WP_002356991.1 1814341..1814616(+) (comGC/cglC) [Enterococcus faecalis strain N4E]
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
MKKKQKYAGFTLLEMLIVLLIISVLILLFVPNLAKHKETVDKKGNEAIVKIVESQIELYTLEKNKTPSLNELVNEGYITK
EQLDKYTAEKQ
Nucleotide
Download Length: 276 bp
>NTDB_id=100770 QUD80_RS08540 WP_002356991.1 1814341..1814616(+) (comGC/cglC) [Enterococcus faecalis strain N4E]
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
ATGAAAAAGAAACAAAAATACGCAGGGTTTACATTATTAGAAATGTTGATTGTCTTATTGATTATTTCCGTATTGATTTT
ACTTTTTGTTCCTAACTTAGCGAAACATAAAGAAACAGTTGATAAAAAAGGCAATGAAGCAATCGTAAAAATTGTAGAAT
CACAAATCGAGCTCTACACACTAGAAAAAAATAAGACGCCTTCCTTAAATGAATTAGTCAACGAAGGCTACATTACTAAA
GAGCAGTTAGATAAATATACAGCAGAAAAGCAATGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGC/cglC | Streptococcus pneumoniae Rx1 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae D39 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae R6 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus pneumoniae TIGR4 |
63.095 |
92.308 |
0.582 |
| comGC/cglC | Streptococcus mitis NCTC 12261 |
61.905 |
92.308 |
0.571 |
| comGC/cglC | Streptococcus mitis SK321 |
61.176 |
93.407 |
0.571 |
| comGC | Lactococcus lactis subsp. cremoris KW2 |
58.14 |
94.505 |
0.549 |
| comYC | Streptococcus gordonii str. Challis substr. CH1 |
56.322 |
95.604 |
0.538 |
| comYC | Streptococcus suis isolate S10 |
52.326 |
94.505 |
0.495 |
| comYC | Streptococcus mutans UA159 |
57.692 |
85.714 |
0.495 |
| comYC | Streptococcus mutans UA140 |
57.692 |
85.714 |
0.495 |
| comGC | Latilactobacillus sakei subsp. sakei 23K |
46.154 |
100 |
0.462 |
| comGC | Staphylococcus aureus MW2 |
46.835 |
86.813 |
0.407 |
| comGC | Staphylococcus aureus N315 |
46.835 |
86.813 |
0.407 |
| comGC | Bacillus subtilis subsp. subtilis str. 168 |
48.649 |
81.319 |
0.396 |