Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | ABKA22_RS09950 | Genome accession | NZ_CP157287 |
| Coordinates | 1996061..1996486 (-) | Length | 141 a.a. |
| NCBI ID | WP_348618883.1 | Uniprot ID | - |
| Organism | Lactococcus lactis strain BIM B-1834 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1960687..2007433 | 1996061..1996486 | within | 0 |
Gene organization within MGE regions
Location: 1960687..2007433
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ABKA22_RS09710 (ABKA22_09710) | pknB | 1960687..1962570 (-) | 1884 | WP_348618816.1 | Stk1 family PASTA domain-containing Ser/Thr kinase | - |
| ABKA22_RS09715 (ABKA22_09715) | - | 1962570..1963346 (-) | 777 | WP_003130802.1 | Stp1/IreP family PP2C-type Ser/Thr phosphatase | - |
| ABKA22_RS09720 (ABKA22_09720) | rsmB | 1963427..1964701 (-) | 1275 | WP_014570715.1 | 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB | - |
| ABKA22_RS09730 (ABKA22_09730) | - | 1965136..1965372 (-) | 237 | WP_011834818.1 | bacteriophage holin | - |
| ABKA22_RS09735 (ABKA22_09735) | - | 1965564..1965947 (-) | 384 | WP_029344147.1 | hypothetical protein | - |
| ABKA22_RS09740 (ABKA22_09740) | - | 1965947..1966399 (-) | 453 | WP_230579356.1 | type II toxin-antitoxin system antitoxin SocA domain-containing protein | - |
| ABKA22_RS09745 (ABKA22_09745) | - | 1966610..1967389 (-) | 780 | WP_348618820.1 | peptidoglycan amidohydrolase family protein | - |
| ABKA22_RS09750 (ABKA22_09750) | - | 1967389..1967676 (-) | 288 | WP_348618822.1 | phage holin | - |
| ABKA22_RS09755 (ABKA22_09755) | - | 1967702..1969264 (-) | 1563 | WP_348618824.1 | BppU family phage baseplate upper protein | - |
| ABKA22_RS09760 (ABKA22_09760) | - | 1969276..1969500 (-) | 225 | WP_010905920.1 | hemolysin XhlA family protein | - |
| ABKA22_RS09765 (ABKA22_09765) | - | 1969624..1971909 (-) | 2286 | WP_348618827.1 | BppU family phage baseplate upper protein | - |
| ABKA22_RS09770 (ABKA22_09770) | - | 1971931..1974747 (-) | 2817 | WP_348618829.1 | phage tail spike protein | - |
| ABKA22_RS09775 (ABKA22_09775) | - | 1974747..1975508 (-) | 762 | WP_348618831.1 | distal tail protein Dit | - |
| ABKA22_RS09780 (ABKA22_09780) | - | 1975522..1978335 (-) | 2814 | WP_348618833.1 | phage tail tape measure protein | - |
| ABKA22_RS09785 (ABKA22_09785) | - | 1978350..1978613 (-) | 264 | WP_043994770.1 | hypothetical protein | - |
| ABKA22_RS09790 (ABKA22_09790) | - | 1978709..1979044 (-) | 336 | WP_015966829.1 | tail assembly chaperone | - |
| ABKA22_RS09795 (ABKA22_09795) | - | 1979160..1979657 (-) | 498 | WP_267165180.1 | phage major tail protein, TP901-1 family | - |
| ABKA22_RS09800 (ABKA22_09800) | - | 1979668..1980063 (-) | 396 | WP_348618836.1 | phage capsid protein | - |
| ABKA22_RS09805 (ABKA22_09805) | - | 1980060..1980398 (-) | 339 | WP_014570728.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| ABKA22_RS09810 (ABKA22_09810) | - | 1980395..1980706 (-) | 312 | WP_032398561.1 | hypothetical protein | - |
| ABKA22_RS09815 (ABKA22_09815) | - | 1980703..1981035 (-) | 333 | WP_348618839.1 | phage head-tail connector protein | - |
| ABKA22_RS09820 (ABKA22_09820) | - | 1981022..1981219 (-) | 198 | WP_014570729.1 | HeH/LEM domain-containing protein | - |
| ABKA22_RS09825 (ABKA22_09825) | - | 1981219..1982046 (-) | 828 | WP_348619249.1 | N4-gp56 family major capsid protein | - |
| ABKA22_RS09830 (ABKA22_09830) | - | 1982042..1982737 (-) | 696 | WP_348618842.1 | DUF4355 domain-containing protein | - |
| ABKA22_RS09835 (ABKA22_09835) | - | 1982861..1983040 (-) | 180 | WP_348618844.1 | hypothetical protein | - |
| ABKA22_RS09840 (ABKA22_09840) | - | 1983099..1983431 (-) | 333 | WP_348618846.1 | YjcQ family protein | - |
| ABKA22_RS09845 (ABKA22_09845) | - | 1983477..1984517 (-) | 1041 | WP_348618848.1 | minor capsid protein | - |
| ABKA22_RS09850 (ABKA22_09850) | - | 1984521..1985891 (-) | 1371 | WP_348618850.1 | phage portal protein | - |
| ABKA22_RS09855 (ABKA22_09855) | terL | 1985904..1987292 (-) | 1389 | WP_348618852.1 | phage terminase large subunit | - |
| ABKA22_RS09860 (ABKA22_09860) | - | 1987285..1987695 (-) | 411 | WP_011676523.1 | terminase | - |
| ABKA22_RS09865 (ABKA22_09865) | - | 1987932..1988354 (-) | 423 | WP_260311634.1 | RinA family protein | - |
| ABKA22_RS09870 (ABKA22_09870) | - | 1989007..1989189 (-) | 183 | WP_010905705.1 | hypothetical protein | - |
| ABKA22_RS09875 (ABKA22_09875) | - | 1989186..1989485 (-) | 300 | WP_348618855.1 | hypothetical protein | - |
| ABKA22_RS09880 (ABKA22_09880) | - | 1989486..1989701 (-) | 216 | WP_348618857.1 | DUF1660 domain-containing protein | - |
| ABKA22_RS09885 (ABKA22_09885) | - | 1989698..1989916 (-) | 219 | WP_348618859.1 | hypothetical protein | - |
| ABKA22_RS09890 (ABKA22_09890) | - | 1989963..1990655 (-) | 693 | WP_348618864.1 | hypothetical protein | - |
| ABKA22_RS09895 (ABKA22_09895) | - | 1990652..1991002 (-) | 351 | WP_348618866.1 | hypothetical protein | - |
| ABKA22_RS09900 (ABKA22_09900) | dut | 1991005..1991424 (-) | 420 | WP_348618868.1 | dUTP diphosphatase | - |
| ABKA22_RS09905 (ABKA22_09905) | - | 1991421..1991990 (-) | 570 | WP_348618870.1 | DUF1642 domain-containing protein | - |
| ABKA22_RS09910 (ABKA22_09910) | - | 1991983..1992189 (-) | 207 | WP_011676933.1 | DUF1125 domain-containing protein | - |
| ABKA22_RS09915 (ABKA22_09915) | - | 1992203..1992727 (-) | 525 | WP_348618872.1 | hypothetical protein | - |
| ABKA22_RS09920 (ABKA22_09920) | - | 1992836..1993075 (-) | 240 | WP_348618874.1 | DUF1031 family protein | - |
| ABKA22_RS09925 (ABKA22_09925) | - | 1993072..1993377 (-) | 306 | WP_348618876.1 | hypothetical protein | - |
| ABKA22_RS09930 (ABKA22_09930) | - | 1993382..1993771 (-) | 390 | WP_348618878.1 | RusA family crossover junction endodeoxyribonuclease | - |
| ABKA22_RS09935 (ABKA22_09935) | dcm | 1993768..1994880 (-) | 1113 | WP_289452664.1 | DNA (cytosine-5-)-methyltransferase | - |
| ABKA22_RS09940 (ABKA22_09940) | - | 1994867..1995142 (-) | 276 | WP_336255775.1 | hypothetical protein | - |
| ABKA22_RS09945 (ABKA22_09945) | - | 1995126..1995932 (-) | 807 | WP_348618881.1 | helix-turn-helix domain-containing protein | - |
| ABKA22_RS09950 (ABKA22_09950) | ssb | 1996061..1996486 (-) | 426 | WP_348618883.1 | single-stranded DNA-binding protein | Machinery gene |
| ABKA22_RS09955 (ABKA22_09955) | - | 1996479..1997237 (-) | 759 | WP_348618885.1 | Rad52/Rad22 family DNA repair protein | - |
| ABKA22_RS09960 (ABKA22_09960) | - | 1997246..1997641 (-) | 396 | WP_348618887.1 | hypothetical protein | - |
| ABKA22_RS09965 (ABKA22_09965) | - | 1997740..1997913 (-) | 174 | WP_014573167.1 | putative transcriptional regulator | - |
| ABKA22_RS09970 (ABKA22_09970) | - | 1997944..1998180 (-) | 237 | WP_259743211.1 | DUF1408 domain-containing protein | - |
| ABKA22_RS09975 (ABKA22_09975) | - | 1998284..1998784 (+) | 501 | WP_101913573.1 | hypothetical protein | - |
| ABKA22_RS09980 (ABKA22_09980) | - | 1998762..1999010 (-) | 249 | WP_348618890.1 | hypothetical protein | - |
| ABKA22_RS09985 (ABKA22_09985) | - | 1999105..1999374 (-) | 270 | WP_023164536.1 | hypothetical protein | - |
| ABKA22_RS09990 (ABKA22_09990) | - | 1999387..2000175 (-) | 789 | WP_312257963.1 | phage antirepressor KilAC domain-containing protein | - |
| ABKA22_RS09995 (ABKA22_09995) | - | 2000188..2000427 (-) | 240 | WP_023189646.1 | helix-turn-helix transcriptional regulator | - |
| ABKA22_RS10000 (ABKA22_10000) | - | 2000581..2001378 (+) | 798 | WP_348618893.1 | hypothetical protein | - |
| ABKA22_RS10005 (ABKA22_10005) | - | 2001398..2001568 (-) | 171 | WP_058224702.1 | putative transcriptional regulator | - |
| ABKA22_RS10010 (ABKA22_10010) | - | 2001843..2002406 (+) | 564 | WP_014570764.1 | helix-turn-helix transcriptional regulator | - |
| ABKA22_RS10015 (ABKA22_10015) | - | 2002412..2002846 (+) | 435 | WP_031559266.1 | zinc peptidase | - |
| ABKA22_RS10020 (ABKA22_10020) | - | 2002860..2003195 (+) | 336 | WP_031559267.1 | hypothetical protein | - |
| ABKA22_RS10025 (ABKA22_10025) | - | 2003262..2004443 (+) | 1182 | WP_251904598.1 | site-specific integrase | - |
| ABKA22_RS10030 (ABKA22_10030) | - | 2004743..2005249 (-) | 507 | WP_003131479.1 | Asp23/Gls24 family envelope stress response protein | - |
| ABKA22_RS10035 (ABKA22_10035) | - | 2005270..2005458 (-) | 189 | WP_012898445.1 | DUF2273 domain-containing protein | - |
| ABKA22_RS10040 (ABKA22_10040) | amaP | 2005469..2006029 (-) | 561 | WP_010906186.1 | alkaline shock response membrane anchor protein AmaP | - |
| ABKA22_RS10045 (ABKA22_10045) | - | 2006057..2006299 (-) | 243 | WP_003131476.1 | GlsB/YeaQ/YmgE family stress response membrane protein | - |
| ABKA22_RS10050 (ABKA22_10050) | fmt | 2006474..2007433 (-) | 960 | WP_251906059.1 | methionyl-tRNA formyltransferase | - |
Sequence
Protein
Download Length: 141 a.a. Molecular weight: 15712.44 Da Isoelectric Point: 5.1972
>NTDB_id=1005446 ABKA22_RS09950 WP_348618883.1 1996061..1996486(-) (ssb) [Lactococcus lactis strain BIM B-1834]
MINNVTLVGRITKEPELRYTPQNKAVASFTLAVNRQFKNANGEREADFINCVIWGKSAENLANWTHKGQLIGVIGNIQTR
NYENQQGQRVYVTEVVASNFQVLEKSNQANGERVGNPAAKPQNNDSFGSDPMEISDDDLPF
MINNVTLVGRITKEPELRYTPQNKAVASFTLAVNRQFKNANGEREADFINCVIWGKSAENLANWTHKGQLIGVIGNIQTR
NYENQQGQRVYVTEVVASNFQVLEKSNQANGERVGNPAAKPQNNDSFGSDPMEISDDDLPF
Nucleotide
Download Length: 426 bp
>NTDB_id=1005446 ABKA22_RS09950 WP_348618883.1 1996061..1996486(-) (ssb) [Lactococcus lactis strain BIM B-1834]
ATGATTAACAATGTCACTCTAGTAGGAAGAATCACTAAAGAACCTGAACTTAGATATACACCACAAAATAAAGCAGTTGC
TTCATTTACTCTTGCAGTTAATCGTCAATTTAAAAATGCTAATGGAGAAAGAGAAGCTGACTTCATCAATTGTGTTATCT
GGGGTAAATCAGCCGAAAACTTGGCCAATTGGACTCATAAAGGTCAATTAATTGGAGTTATTGGGAATATCCAAACTCGA
AACTATGAGAACCAACAAGGGCAACGTGTTTATGTTACGGAGGTTGTCGCAAGTAATTTCCAAGTACTAGAAAAAAGTAA
TCAAGCAAATGGTGAACGAGTTGGTAATCCAGCTGCAAAACCACAAAATAACGATTCTTTTGGAAGTGATCCAATGGAAA
TTTCAGATGATGACCTACCATTCTAA
ATGATTAACAATGTCACTCTAGTAGGAAGAATCACTAAAGAACCTGAACTTAGATATACACCACAAAATAAAGCAGTTGC
TTCATTTACTCTTGCAGTTAATCGTCAATTTAAAAATGCTAATGGAGAAAGAGAAGCTGACTTCATCAATTGTGTTATCT
GGGGTAAATCAGCCGAAAACTTGGCCAATTGGACTCATAAAGGTCAATTAATTGGAGTTATTGGGAATATCCAAACTCGA
AACTATGAGAACCAACAAGGGCAACGTGTTTATGTTACGGAGGTTGTCGCAAGTAATTTCCAAGTACTAGAAAAAAGTAA
TCAAGCAAATGGTGAACGAGTTGGTAATCCAGCTGCAAAACCACAAAATAACGATTCTTTTGGAAGTGATCCAATGGAAA
TTTCAGATGATGACCTACCATTCTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Latilactobacillus sakei subsp. sakei 23K |
55.294 |
100 |
0.667 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
52.326 |
100 |
0.638 |
| ssbB/cilA | Streptococcus pneumoniae TIGR4 |
44.681 |
100 |
0.447 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
44.681 |
100 |
0.447 |
| ssbB/cilA | Streptococcus mitis NCTC 12261 |
44.681 |
100 |
0.447 |
| ssbB/cilA | Streptococcus pneumoniae Rx1 |
43.972 |
100 |
0.44 |
| ssbB/cilA | Streptococcus pneumoniae D39 |
43.972 |
100 |
0.44 |
| ssbB/cilA | Streptococcus pneumoniae R6 |
43.972 |
100 |
0.44 |
| ssbB/cilA | Streptococcus mitis SK321 |
43.972 |
100 |
0.44 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
58.654 |
73.759 |
0.433 |
| ssbA | Streptococcus mutans UA159 |
40.426 |
100 |
0.404 |
| ssbB | Lactococcus lactis subsp. cremoris KW2 |
49.515 |
73.05 |
0.362 |